Uromucoid (UMOD) (NM_003361) Human Tagged ORF Clone

CAT#: RC223787

Reviews ()
Write a review

UMOD (Myc-DDK-tagged)-Human uromodulin (UMOD), transcript variant 1



  "NM_003361" in other vectors (4)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 118.00

USD 869.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol UMOD
Synonyms ADMCKD2; ADTKD1; FJHN; HNFJ; HNFJ1; MCKD2; THGP; THP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223787 representing NM_003361
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCAGCCATCTCTGACTTGGATGCTGATGGTGGTGGTGGCCTCTTGGTTCATCACAACTGCAGCCA
CTGACACCTCAGAAGCAAGATGGTGCTCTGAATGTCACAGCAATGCCACCTGCACGGAGGATGAGGCCGT
TACGACGTGCACCTGTCAGGAGGGCTTCACCGGCGATGGCCTGACCTGCGTGGACCTGGATGAGTGCGCC
ATTCCTGGAGCTCACAACTGCTCCGCCAACAGCAGCTGCGTAAACACGCCAGGCTCCTTCTCCTGCGTCT
GCCCCGAAGGCTTCCGCCTGTCGCCCGGTCTCGGCTGCACAGACGTGGATGAGTGCGCTGAGCCTGGGCT
TAGCCACTGCCACGCCCTGGCCACATGTGTCAATGTGGTGGGCAGCTACTTGTGCGTATGCCCCGCGGGC
TACCGGGGGGATGGATGGCACTGTGAGTGCTCCCCGGGCTCCTGCGGGCCGGGGTTGGACTGCGTGCCCG
AGGGCGACGCGCTCGTGTGCGCGGATCCGTGCCAGGCGCACCGCACCCTGGACGAGTACTGGCGCAGCAC
CGAGTACGGGGAGGGCTACGCCTGCGACACGGACCTGCGCGGCTGGTACCGCTTCGTGGGCCAGGGCGGT
GCGCGCATGGCCGAGACCTGCGTGCCAGTCCTGCGCTGCAACACGGCCGCCCCCATGTGGCTCAATGGCA
CGCATCCGTCCAGCGACGAGGGCATCGTGAGCCGCAAGGCCTGCGCGCACTGGAGCGGCCACTGCTGCCT
GTGGGATGCGTCCGTCCAGGTGAAGGCCTGTGCCGGCGGCTACTACGTCTACAACCTGACAGCGCCCCCC
GAGTGTCACCTGGCGTACTGCACAGACCCCAGCTCCGTGGAGGGGACGTGTGAGGAGTGCAGTATAGACG
AGGACTGCAAATCGAATAATGGCAGATGGCACTGCCAGTGCAAACAGGACTTCAACATCACTGATATCTC
CCTCCTGGAGCACAGGCTGGAATGTGGGGCCAATGACATGAAGGTGTCGCTGGGCAAGTGCCAGCTGAAG
AGTCTGGGCTTCGACAAGGTCTTCATGTACCTGAGTGACAGCCGGTGCTCGGGCTTCAATGACAGAGACA
ACCGGGACTGGGTGTCTGTAGTGACCCCAGCCCGGGATGGCCCCTGTGGGACAGTGTTGACGAGGAATGA
AACCCATGCCACTTACAGCAACACCCTCTACCTGGCAGATGAGATCATCATCCGTGACCTCAACATCAAA
ATCAACTTTGCATGCTCCTACCCCCTGGACATGAAAGTCAGCCTGAAGACCGCCCTACAGCCAATGGTCA
GTGCTCTAAACATCAGAGTGGGCGGGACCGGCATGTTCACCGTGCGGATGGCGCTCTTCCAGACCCCTTC
CTACACGCAGCCCTACCAAGGCTCCTCCGTGACACTGTCCACTGAGGCTTTTCTCTACGTGGGCACCATG
TTGGATGGGGGCGACCTGTCCCGATTTGCACTGCTCATGACCAACTGCTATGCCACACCCAGTAGCAATG
CCACGGACCCCCTGAAGTACTTCATCATCCAGGACAGATGCCCACACACTAGAGACTCAACTATCCAAGT
GGTGGAGAATGGGGAGTCCTCCCAGGGCCGATTTTCCGTCCAGATGTTCCGGTTTGCTGGAAACTATGAC
CTAGTCTACCTGCACTGTGAAGTCTATCTCTGTGACACCATGAATGAAAAGTGCAAGCCTACCTGCTCTG
GGACCAGATTCCGAAGTGGGAGTGTCATAGATCAATCCCGTGTCCTGAACTTGGGTCCCATCACACGGAA
AGGTGTCCAGGCCACAGTCTCAAGGGCTTTTAGCAGCTTGGGGCTCCTGAAAGTCTGGCTGCCTCTGCTT
CTCTCGGCCACCTTGACCCTGACTTTTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223787 representing NM_003361
Red=Cloning site Green=Tags(s)

MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECA
IPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAG
YRGDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRFVGQGG
ARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPP
ECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLK
SLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIK
INFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEAFLYVGTM
LDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYD
LVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPLL
LSATLTLTFQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003361
ORF Size 1920 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003361.4
RefSeq Size 2327 bp
RefSeq ORF 1923 bp
Locus ID 7369
UniProt ID P07911
Cytogenetics 16p12.3
Domains zona_pellucida, EGF_CA, EGF, EGF
MW 69.76 kDa
Gene Summary The protein encoded by this gene is the most abundant protein in mammalian urine under physiological conditions. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the luminal cell surface of the loop of Henle. This protein may act as a constitutive inhibitor of calcium crystallization in renal fluids. Excretion of this protein in urine may provide defense against urinary tract infections caused by uropathogenic bacteria. Defects in this gene are associated with the renal disorders medullary cystic kidney disease-2 (MCKD2), glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI), and familial juvenile hyperuricemic nephropathy (FJHN). Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Other Versions

Other products for "UMOD"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Rabbit Polyclonal Anti-UMOD Antibody
    • 100 ul

USD 475.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.