IQGAP2 (NM_006633) Human Tagged ORF Clone

CAT#: RC223783

Reviews ()
Write a review

IQGAP2 (Myc-DDK-tagged)-Human IQ motif containing GTPase activating protein 2 (IQGAP2)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,870.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IQGAP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223783 representing NM_006633
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCACACGAAGAGCTGCCGTCGCTGCAGAGACCCCGCTATGGCTCTATTGTGGACGATGAAAGGCTCT
CTGCAGAGGAGATGGATGAGAGGAGGCGGCAGAACATTGCTTATGAATATCTGTGCCACTTAGAGGAAGC
CAAAAGGTGGATGGAAGTTTGCTTAGTTGAAGAATTGCCACCAACCACTGAATTGGAAGAAGGGCTCCGG
AATGGAGTTTACCTTGCAAAGTTAGCCAAGTTCTTTGCCCCGAAAATGGTATCAGAGAAAAAGATCTATG
ATGTGGAACAAACACGTTATAAGAAGTCTGGCCTTCATTTTCGACACACAGATAATACCGTCCAGTGGTT
AAGAGCGATGGAGTCTATTGGTCTACCCAAGATATTTTATCCAGAAACAACAGATGTCTATGATCGGAAA
AACATACCAAGAATGATATATTGCATTCACGCACTGAGTTTGTATCTGTTCAAACTAGGAATAGCACCCC
AGATCCAGGATTTGTTGGGCAAAGTAGACTTCACAGAGGAGGAAATCAGTAATATGAGAAAAGAACTTGA
GAAATATGGAATACAGATGCCATCTTTCAGCAAAATAGGTGGTATTCTGGCCAATGAACTGTCCGTGGAT
GAAGCTGCATTACATGCTGCAGTTATAGCCATTAATGAAGCAGTTGAAAAAGGAATAGCAGAGCAAACCG
TTGTAACACTAAGAAACCCAAATGCGGTTTTAACTTTAGTGGATGACAACCTTGCACCAGAATATCAGAA
AGAACTCTGGGATGCCAAAAAGAAAAAAGAGGAAAATGCAAGACTGAAGAATAGCTGTATTTCAGAAGAA
GAAAGAGATGCTTATGAAGAACTGCTGACACAAGCAGAAATCCAAGGCAATATTAATAAAGTCAACAGGC
AGGCTGCAGTGGACCATATCAATGCTGTCATTCCGGAAGGTGACCCCGAGAATACGCTGCTTGCACTGAA
GAAACCAGAGGCCCAGCTGCCTGCTGTTTATCCCTTTGCTGCTGCCATGTATCAGAACGAACTTTTCAAC
CTCCAGAAACAGAACACCATGAACTACTTGGCCCACGAGGAGCTTTTGATTGCTGTGGAAATGTTGTCTG
CTGTTGCTTTACTAAACCAGGCCTTGGAAAGCAACGATCTTGTGTCTGTGCAGAATCAACTCAGAAGCCC
CGCAATAGGCTTAAACAATCTGGACAAGGCATATGTGGAACGTTATGCAAACACACTACTCTCTGTTAAA
CTAGAAGTTTTATCCCAAGGGCAAGATAACTTAAGCTGGAATGAAATTCAGAATTGTATTGATATGGTTA
ATGCTCAAATTCAAGAAGAAAATGACCGAGTTGTAGCTGTAGGGTACATCAATGAAGCTATTGATGAAGG
GAATCCTTTGAGGACTTTAGAAACTTTGCTCCTACCTACTGCGAATATTAGTGATGTGGACCCAGCCCAT
GCCCAGCACTACCAGGATGTTTTATACCATGCTAAATCACAGAAACTCGGAGACTCTGAGAGTGTTTCCA
AAGTGCTTTGGCTGGATGAGATACAGCAAGCCGTCGATGAGGCCAACGTGGACGAGGACAGAGCAAAACA
ATGGGTTACTCTGGTGGTTGATGTTAATCAGTGTTTGGAAGGAAAAAAATCAAGTGATATTTTGTCTGTA
TTGAAGTCTTCCACTTCTAATGCAAATGACATAATCCCGGAGTGTGCTGACAAATACTATGATGCCCTTG
TGAAGGCAAAAGAGCTCAAATCTGAAAGAGTGTCTAGTGACGGTTCATGGCTCAAACTCAACCTGCACAA
AAAATATGACTACTATTACAACACTGATTCAAAAGAGAGTTCCTGGGTCACACCTGAATCATGCTTCTAT
AAAGAATCATGGCTCACAGGAAAAGAAATCGAGGACATTATTGAGGAAGTCACAGTAGGTTACATTCGTG
AGAATATATGGTCTGCTTCAGAAGAGTTGCTTCTTCGCTTTCAAGCCACAAGCTCAGGACCCATCCTTAG
GGAAGAGTTTGAAGCTAGAAAATCATTTTTGCATGAACAAGAAGAGAATGTGGTCAAAATACAGGCTTTT
TGGAAAGGATATAAACAACGGAAGGAGTATATGCACAGGCGGCAAACGTTCATTGATAATACTGATTCTG
TTGTGAAGATTCAGTCCTGGTTCCGAATGGCAACTGCAAGAAAGAGCTATCTTTCAAGACTACAGTATTT
CAGAGATCATAATAATGAAATTGTGAAAATACAGTCACTGTTGAGAGCGAACAAAGCTAGAGATGACTAC
AAAACATTGGTTGGCTCTGAAAACCCACCATTAACAGTAATTCGCAAATTTGTATACCTGCTGGACCAAA
GTGATTTGGATTTCCAGGAGGAACTAGAGGTTGCACGATTAAGGGAAGAAGTAGTGACCAAGATCAGGGC
CAATCAACAGCTGGAAAAAGACCTGAACCTGATGGACATCAAGATTGGACTGCTGGTGAAGAACAGGATC
ACACTAGAGGATGTAATTTCACACAGTAAAAAGCTGAACAAGAAAAAAGGAGGAGAAATGGAAATACTGA
ATAACACCGACAACCAAGGAATAAAAAGTTTGAGTAAGGAGAGGAGAAAAACACTAGAAACATATCAGCA
GCTGTTTTACCTTTTACAGACCAACCCTTTATACTTGGCTAAGCTGATTTTCCAGATGCCACAGAACAAG
TCCACTAAATTTATGGATACTGTTATTTTCACACTATATAATTATGCCTCTAATCAGCGAGAAGAATATC
TACTTCTCAAGCTTTTTAAAACTGCTCTGGAGGAAGAAATAAAATCAAAAGTGGACCAGGTACAGGACAT
AGTTACTGGTAACCCTACAGTCATCAAGATGGTCGTCAGCTTCAATAGAGGTGCCCGGGGACAGAACACC
CTGCGCCAACTCCTGGCTCCAGTGGTAAAAGAGATCATCGACGACAAGTCGCTGATTATCAACACAAACC
CTGTAGAGGTGTACAAGGCTTGGGTGAACCAACTAGAAACACAGACTGGAGAGGCCAGCAAGTTGCCTTA
TGATGTGACCACAGAACAAGCTCTAACATACCCAGAAGTGAAAAATAAACTGGAGGCTTCCATTGAGAAC
CTGAGAAGGGTCACCGACAAAGTCCTGAATTCTATCATTTCTTCCCTTGATCTACTGCCTTATGGATTGA
GGTATATAGCCAAAGTACTGAAGAATTCGATCCATGAGAAATTCCCCGATGCAACAGAAGATGAGCTATT
AAAGATTGTTGGAAACCTCCTGTACTATCGGTACATGAATCCAGCCATTGTAGCTCCAGATGGCTTTGAT
ATCATCGACATGACAGCTGGAGGTCAGATAAATTCTGACCAAAGGAGAAACTTAGGATCAGTGGCCAAGG
TTCTTCAGCACGCAGCCTCCAACAAGCTGTTTGAAGGAGAAAATGAGCATCTCTCATCTATGAACAATTA
TTTATCAGAGACGTATCAGGAATTCAGGAAATATTTCAAAGAAGCATGTAATGTCCCTGAGCCAGAAGAG
AAGTTTAATATGGACAAATACACAGACCTGGTGACAGTCAGCAAACCAGTCATTTATATTTCAATTGAAG
AAATCATCAGCACACACTCACTCCTGTTGGAACACCAGGATGCAATTGCCCCTGAGAAAAATGACTTACT
GAGTGAATTGCTGGGGTCGCTGGGAGAGGTGCCAACCGTGGAATCTTTTCTTGGGGAAGGAGCAGTTGAC
CCCAATGACCCTAACAAGGCAAATACACTAAGTCAGCTTTCAAAGACCGAGATTTCTCTTGTCTTGACAA
GCAAATATGACATAGAGGACGGTGAAGCTATAGATAGCCGAAGCCTCATGATAAAGACCAAGAAGCTGAT
AATTGATGTGATCCGGAACCAGCCAGGGAACACATTGACAGAAATCTTAGAGACACCAGCAACTGCGCAA
CAGGAGGTAGACCATGCCACGGACATGGTGAGCCGTGCAATGATAGATTCCAGGACTCCAGAAGAAATGA
AGCATAGCCAATCTATGATTGAAGATGCACAGCTGCCTCTTGAGCAGAAGAAGAGGAAAATCCAGAGGAA
TCTTCGGACGTTGGAACAGACTGGACACGTGTCATCCGAAAATAAATACCAAGACATTCTCAATGAGATT
GCCAAGGATATTCGAAATCAAAGAATCTATCGTAAGCTTCGAAAAGCTGAATTGGCAAAACTTCAGCAGA
CCCTGAATGCACTTAACAAGAAGGCAGCATTTTATGAAGAGCAAATCAATTATTATGACACCTACATAAA
GACTTGTTTAGACAACTTAAAAAGAAAAAATACTCGGAGATCAATTAAACTAGATGGAAAAGGAGAACCC
AAAGGGGCGAAGAGAGCGAAGCCAGTGAAGTACACTGCAGCAAAGCTGCATGAGAAAGGTGTCCTGCTAG
ATATAGATGATCTTCAAACAAACCAGTTTAAGAATGTTACATTTGATATCATAGCTACTGAAGATGTAGG
CATTTTCGATGTAAGATCAAAATTCCTTGGTGTTGAGATGGAAAAGGTGCAACTCAATATTCAGGATTTA
CTTCAGATGCAATATGAAGGAGTAGCTGTAATGAAAATGTTTGATAAGGTTAAAGTGAATGTAAACCTTC
TCATATACCTGCTGAACAAGAAGTTCTATGGAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223783 representing NM_006633
Red=Cloning site Green=Tags(s)

MPHEELPSLQRPRYGSIVDDERLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLVEELPPTTELEEGLR
NGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAMESIGLPKIFYPETTDVYDRK
NIPRMIYCIHALSLYLFKLGIAPQIQDLLGKVDFTEEEISNMRKELEKYGIQMPSFSKIGGILANELSVD
EAALHAAVIAINEAVEKGIAEQTVVTLRNPNAVLTLVDDNLAPEYQKELWDAKKKKEENARLKNSCISEE
ERDAYEELLTQAEIQGNINKVNRQAAVDHINAVIPEGDPENTLLALKKPEAQLPAVYPFAAAMYQNELFN
LQKQNTMNYLAHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLLSVK
LEVLSQGQDNLSWNEIQNCIDMVNAQIQEENDRVVAVGYINEAIDEGNPLRTLETLLLPTANISDVDPAH
AQHYQDVLYHAKSQKLGDSESVSKVLWLDEIQQAVDEANVDEDRAKQWVTLVVDVNQCLEGKKSSDILSV
LKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSWLKLNLHKKYDYYYNTDSKESSWVTPESCFY
KESWLTGKEIEDIIEEVTVGYIRENIWSASEELLLRFQATSSGPILREEFEARKSFLHEQEENVVKIQAF
WKGYKQRKEYMHRRQTFIDNTDSVVKIQSWFRMATARKSYLSRLQYFRDHNNEIVKIQSLLRANKARDDY
KTLVGSENPPLTVIRKFVYLLDQSDLDFQEELEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRI
TLEDVISHSKKLNKKKGGEMEILNNTDNQGIKSLSKERRKTLETYQQLFYLLQTNPLYLAKLIFQMPQNK
STKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTGNPTVIKMVVSFNRGARGQNT
LRQLLAPVVKEIIDDKSLIINTNPVEVYKAWVNQLETQTGEASKLPYDVTTEQALTYPEVKNKLEASIEN
LRRVTDKVLNSIISSLDLLPYGLRYIAKVLKNSIHEKFPDATEDELLKIVGNLLYYRYMNPAIVAPDGFD
IIDMTAGGQINSDQRRNLGSVAKVLQHAASNKLFEGENEHLSSMNNYLSETYQEFRKYFKEACNVPEPEE
KFNMDKYTDLVTVSKPVIYISIEEIISTHSLLLEHQDAIAPEKNDLLSELLGSLGEVPTVESFLGEGAVD
PNDPNKANTLSQLSKTEISLVLTSKYDIEDGEAIDSRSLMIKTKKLIIDVIRNQPGNTLTEILETPATAQ
QEVDHATDMVSRAMIDSRTPEEMKHSQSMIEDAQLPLEQKKRKIQRNLRTLEQTGHVSSENKYQDILNEI
AKDIRNQRIYRKLRKAELAKLQQTLNALNKKAAFYEEQINYYDTYIKTCLDNLKRKNTRRSIKLDGKGEP
KGAKRAKPVKYTAAKLHEKGVLLDIDDLQTNQFKNVTFDIIATEDVGIFDVRSKFLGVEMEKVQLNIQDL
LQMQYEGVAVMKMFDKVKVNVNLLIYLLNKKFYGK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006633
ORF Size 4725 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006633.1, NP_006624.1
RefSeq Size 5767 bp
RefSeq ORF 4728 bp
Locus ID 10788
UniProt ID Q13576
Cytogenetics 5q13.3
Domains IQ, RasGAP_C, CH, RasGAP
Protein Families Druggable Genome
Protein Pathways Regulation of actin cytoskeleton
MW 180.4 kDa
Gene Summary This gene encodes a member of the IQGAP family. The encoded protein contains three IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. This protein interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. It also acts as a tumor suppressor and has been found to play a role in regulating innate antiviral responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017]
Other products for "IQGAP2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.