FADS2 (NM_004265) Human Tagged ORF Clone

CAT#: RC223780

Reviews ()
Write a review

FADS2 (Myc-DDK-tagged)-Human fatty acid desaturase 2 (FADS2)



  "NM_004265" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FADS2
Synonyms D6D; DES6; FADSD6; LLCDL2; SLL0262; TU13
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223780 representing NM_004265
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAAGGGAGGGAACCAGGGCGAGGGGGCCGCCGAGCGCGAGGTGTCGGTGCCCACCTTCAGCTGGG
AGGAGATTCAGAAGCATAACCTGCGCACCGACAGGTGGCTGGTCATTGACCGCAAGGTTTACAACATCAC
CAAATGGTCCATCCAGCACCCGGGGGGCCAGCGGGTCATCGGGCACTACGCTGGAGAAGATGCAACGGAT
GCCTTCCGCGCCTTCCACCCTGACCTGGAATTCGTGGGCAAGTTCTTGAAACCCCTGCTGATTGGTGAAC
TGGCCCCGGAGGAGCCCAGCCAGGACCACGGCAAGAACTCAAAGATCACTGAGGACTTCCGGGCCCTGAG
GAAGACGGCTGAGGACATGAACCTGTTCAAGACCAACCACGTGTTCTTCCTCCTCCTCCTGGCCCACATC
ATCGCCCTGGAGAGCATTGCATGGTTCACTGTCTTTTACTTTGGCAATGGCTGGATTCCTACCCTCATCA
CGGCCTTTGTCCTTGCTACCTCTCAGGCCCAAGCTGGATGGCTGCAACATGATTATGGCCACCTGTCTGT
CTACAGAAAACCCAAGTGGAACCACCTTGTCCACAAATTCGTCATTGGCCACTTAAAGGGTGCCTCTGCC
AACTGGTGGAATCATCGCCACTTCCAGCACCACGCCAAGCCTAACATCTTCCACAAGGATCCCGATGTGA
ACATGCTGCACGTGTTTGTTCTGGGCGAATGGCAGCCCATCGAGTACGGCAAGAAGAAGCTGAAATACCT
GCCCTACAATCACCAGCACGAATACTTCTTCCTGATTGGGCCGCCGCTGCTCATCCCCATGTATTTCCAG
TACCAGATCATCATGACCATGATCGTCCATAAGAACTGGGTGGACCTGGCCTGGGCCGTCAGCTACTACA
TCCGGTTCTTCATCACCTACATCCCTTTCTACGGCATCCTGGGAGCCCTCCTTTTCCTCAACTTCATCAG
GTTCCTGGAGAGCCACTGGTTTGTGTGGGTCACACAGATGAATCACATCGTCATGGAGATTGACCAGGAG
GCCTACCGTGACTGGTTCAGTAGCCAGCTGACAGCCACCTGCAACGTGGAGCAGTCCTTCTTCAACGACT
GGTTCAGTGGACACCTTAACTTCCAGATTGAGCACCACCTCTTCCCCACCATGCCCCGGCACAACTTACA
CAAGATCGCCCCGCTGGTGAAGTCTCTATGTGCCAAGCATGGCATTGAATACCAGGAGAAGCCGCTACTG
AGGGCCCTGCTGGACATCATCAGGTCCCTGAAGAAGTCTGGGAAGCTGTGGCTGGACGCCTACCTTCACA
AA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223780 representing NM_004265
Red=Cloning site Green=Tags(s)

MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATD
AFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHVFFLLLLAHI
IALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVIGHLKGASA
NWWNHRHFQHHAKPNIFHKDPDVNMLHVFVLGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQ
YQIIMTMIVHKNWVDLAWAVSYYIRFFITYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQE
AYRDWFSSQLTATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL
RALLDIIRSLKKSGKLWLDAYLHK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004265
ORF Size 1332 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004265.4
RefSeq Size 3149 bp
RefSeq ORF 1335 bp
Locus ID 9415
UniProt ID O95864
Cytogenetics 11q12.2
Domains heme_1, FA_desaturase
Protein Families Transmembrane
Protein Pathways alpha-Linolenic acid metabolism, Biosynthesis of unsaturated fatty acids, PPAR signaling pathway
MW 52.1 kDa
Gene Summary The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]

Other Versions

Other products for "FADS2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit polyclonal FADS2 Antibody (Center)
    • 400 ul

USD 512.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.