PORCN (NM_203475) Human Tagged ORF Clone

CAT#: RC223764

Reviews ()
Write a review

PORCN (Myc-DDK-tagged)-Human porcupine homolog (Drosophila) (PORCN), transcript variant D



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PORCN"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PORCN
Synonyms DHOF; FODH; MG61; PORC; PPN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223764 representing NM_203475
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCTTTAGCCGCCAGGAATTTTTCCAGCAGCTACTGCAAGGCTGTCTCCTGCCTACTGCCCAGC
AGGGCCTTGACCAGATCTGGCTGCTCCTTGCCATCTGCCTCGCCTGCCGCCTCCTCTGGAGGCTCGGGTT
GCCATCCTACCTGAAGCATGCAAGCACCGTGGCAGGCGGGTTCTTCAGCCTCTACCACTTCTTCCAGCTG
CACATGGTTTGGGTCGTGCTGCTCAGCCTCCTGTGCTACCTCGTGCTGTTCCTCTGCCGACATTCCTCCC
ATCGAGGCGTCTTCCTATCCGTCACCATCCTCATCTACCTACTCATGGGTGAGATGCACATGGTAGACAC
CGTGACATGGCACAAGATGCGAGGGGCACAGATGATTGTGGCCATGAAGGCAGTGTCTCTGGGCTTCGAC
CTGGACCGGGGCGAGGTGGGTACGGTGCCCTCGCCAGTGGAGTTCATGGGCTACCTCTACTTCGTGGGCA
CCATCGTCTTCGGGCCCTGGATATCCTTCCACAGCTACCTACAAGCTGTCCAAGGCCGCCCACTGAGCTG
CCGGTGGCTGCAGAAGGTGGCCCGGAGCCTGGCACTGGCCCTGCTGTGCCTTGTGCTGTCCACTTGCGTG
GGCCCCTACCTCTTCCCGTACTTCATCCCCCTCAACGGTGACCGCCTCCTTCGCAACAAGAAACGCAAAG
CCAGGGGCACCATGGTAAGGTGGCTGCGAGCCTACGAGAGTGCTGTCTCCTTCCACTTCAGCAACTATTT
TGTGGGCTTTCTTTCCGAGGCCACGGCCACGTTGGCGGGGGCTGGCTTTACCGAGGAGAAGGATCACCTG
GAATGGGACCTGACGGTGTCCAAGCCACTGAATGTGGAGCTGCCTCGGTCAATGGTGGAAGTTGTCACAA
GCTGGAACCTGCCCATGTCTTATTGGCTAAATAACTATGTTTTCAAGAATGCTCTCCGCCTGGGGACCTT
CTCGGCTGTGCTGGTCACCTATGCAGCCAGCGCCCTCCTACATGGCTTCAGTTTCCACCTGGCTGCGGTC
CTGCTGTCCCTGGCTTTTATCACTTACGTGGAGCATGTCCTCCGGAAGCGCCTGGCTCGGATCCTCAGTG
CCTGTGTCTTGTCAAAGCGGTGCCCGCCAGACTGTTCGCACCAGCATCGCTTGGGCCTGGGGGTGCGAGC
CTTAAACTTGCTCTTTGGAGCTCTGGCCATCTTCCACCTGGCCTACCTGGGCTCCCTGTTTGATGTCGAT
GTGGATGACACCACAGAGGAGCAGGGCTACGGCATGGCATACACTGTCCACAAGTGGTCAGAGCTCAGCT
GGGCCAGTCACTGGGTCACTTTTGGATGCTGGATCTTCTACCGTCTCATAGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223764 representing NM_203475
Red=Cloning site Green=Tags(s)

MATFSRQEFFQQLLQGCLLPTAQQGLDQIWLLLAICLACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQL
HMVWVVLLSLLCYLVLFLCRHSSHRGVFLSVTILIYLLMGEMHMVDTVTWHKMRGAQMIVAMKAVSLGFD
LDRGEVGTVPSPVEFMGYLYFVGTIVFGPWISFHSYLQAVQGRPLSCRWLQKVARSLALALLCLVLSTCV
GPYLFPYFIPLNGDRLLRNKKRKARGTMVRWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHL
EWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLGTFSAVLVTYAASALLHGFSFHLAAV
LLSLAFITYVEHVLRKRLARILSACVLSKRCPPDCSHQHRLGLGVRALNLLFGALAIFHLAYLGSLFDVD
VDDTTEEQGYGMAYTVHKWSELSWASHWVTFGCWIFYRLIG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_203475
ORF Size 1383 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_203475.3
RefSeq Size 1761 bp
RefSeq ORF 1386 bp
Locus ID 64840
UniProt ID Q9H237
Cytogenetics Xp11.23
Protein Families Transmembrane
Protein Pathways Wnt signaling pathway
MW 52.1 kDa
Gene Summary This gene belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the porcupine family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Disruption of this gene is associated with focal dermal hypoplasia, and the encoded protein has been implicated in cancer. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Aug 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.