ATRIP (NM_130384) Human Tagged ORF Clone

CAT#: RC223562

Reviews ()
Write a review
  • TrueORF®

ATRIP (Myc-DDK-tagged)-Human ATR interacting protein (ATRIP), transcript variant 1



  "NM_130384" in other vectors (6)

USD 610.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ATRIP (NM_130384) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ATRIP
Synonyms DKFZp762J2115; FLJ12343; MGC20625; MGC21482; MGC26740
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC223562 representing NM_130384
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGGACCTCCGCGCCAGGCAGCAAGAGGCGGAGCGAGCCCCCGGCGCCTCGCCCCGGCCCGCCGC
CGGGCACCGGGCACCCCCCGAGCAAGCGGGCCCGGGGCTTCTCCGCAGCCGCTGCCCCGGACCCTGACGA
CCCGTTCGGCGCGCATGGGGACTTCACTGCCGACGACCTGGAGGAGCTTGACACCCTCGCGTCACAGGCC
CTGAGCCAATGTCCGGCCGCGGCTCGGGACGTGTCCAGTGATCATAAGGTCCACAGATTATTAGATGGCA
TGTCAAAAAATCCTTCAGGGAAAAACAGAGAAACTGTTCCAATTAAAGATAATTTCGAATTAGAGGTACT
TCAGGCACAATACAAAGAACTTAAAGAAAAGATGAAAGTAATGGAAGAAGAAGTTCTCATTAAGAATGGA
GAAATTAAAATTTTGCGAGACTCACTACATCAGACGGAATCCGTTCTAGAGGAACAGAGAAGATCACATT
TTCTTCTTGAGCAAGAGAAAACCCAAGCACTCAGTGACAAGGAAAAGGAATTCTCCAAAAAGCTCCAATC
ATTGCAGTCTGAACTCCAGTTTAAAGATGCAGAGATGAATGAATTAAGGACAAAGCTCCAGACCAGTGAA
CGAGCAAATAAACTGGCTGCTCCCTCTGTTTCCCATGTCAGTCCTAGGAAAAACCCTTCTGTGGTTATAA
AGCCAGAAGCATGTTCTCCACAATTTGGAAAAACATCTTTTCCTACAAAGGAGTCTTTTAGTGCTAACAT
GTCCCTTCCCCACCCCTGCCAGACGGAGTCAGGATACAAGCCTCTGGTGGGCAGAGAGGATAGTAAGCCC
CACAGTCTGAGAGGTGACTCCATAAAACAAGAAGAGGCCCAGAAAAGCTTTGTTGACAGCTGGAGACAGA
GATCAAACACTCAAGGTTCCATTTTGATAAACCTGCTCCTGAAGCAGCCTTTGATCCCAGGGTCATCCCT
AAGCCTTTGCCACCTCCTGAGTAGTAGTTCTGAGTCTCCTGCTGGCACCCCCCTGCAGCCACCAGGGTTT
GGCAGTACCTTGGCTGGAATGTCAGGCCTCAGGACCACAGGTTCTTATGATGGGTCATTTTCCCTCTCAG
CCCTGAGAGAAGCACAGAACCTGGCATTCACTGGACTGAATCTGGTTGCCCGGAATGAGTGCTCACGTGA
TGGAGACCCAGCAGAGGGAGGCAGAAGGGCCTTCCCACTCTGCCAGCTTCCTGGAGCCGTGCATTTCCTC
CCCCTTGTACAGTTCTTCATCGGCTTACACTGCCAGGCCCTGCAGGACTTGGCAGCTGCTAAGAGAAGCG
GAGCACCTGGGGACTCACCGACACATTCCTCCTGCGTGAGCTCTGGGGTAGAGACCAACCCTGAGGACTC
AGTGTGCATCCTGGAAGGCTTCTCTGTGACTGCACTTAGCATTCTTCAGCACCTGGTGTGCCACAGCGGA
GCAGTCGTCTCCCTATTACTGTCAGGAGTGGGGGCAGATTCTGCTGCTGGGGAAGGAAACAGGAGCCTGG
TTCACAGGCTTAGTGATGGAGATATGACCTCAGCCCTAAGGGGGGTTGCTGATGACCAAGGACAGCACCC
ACTGTTGAAGATGCTTCTTCACCTGTTGGCTTTCTCTTCTGCAGCAACAGGTCACCTTCAAGCCAGTGTC
CTGACCCAGTGCCTTAAGGTTTTGGTGAAATTAGCCGAAAACACTTCCTGTGATTTCTTGCCCAGGTTCC
AGTGTGTGTTCCAAGTGCTGCCAAAGTGCCTCAGCCCAGAGACACCCCTGCCTAGCGTGCTGCTGGCTGT
TGAGCTCCTCTCCCTGCTGGCGGACCACGACCAGCTGGCACCTCAGCTCTGTTCCCACTCAGAAGGCTGC
CTCCTGCTGCTGCTGTACATGTACATCACATCACGGCCTGACAGAGTGGCCTTGGAGACACAATGGCTCC
AGCTGGAACAAGAGGTGGTGTGGCTCCTGGCTAAGCTTGGTGTGCAGAGCCCCTTGCCCCCAGTCACTGG
CTCCAACTGCCAGTGTAATGTGGAGGTGGTCAGAGCGCTCACGGTGATGTTGCACAGACAGTGGCTGACA
GTGCGGAGGGCAGGGGGACCCCCAAGGACCGACCAGCAGAGGCGGACAGTGCGCTGTCTGCGGGACACGG
TGCTGCTGCTGCACGGCCTATCGCAGAAGGACAAGCTCTTCATGATGCACTGCGTGGAGGTCCTGCATCA
GTTTGACCAGGTGATGCCGGGGGTCAGCATGCTCATCCGAGGGCTTCCTGATGTGACGGACTGTGAAGAG
GCAGCCCTGGATGACCTCTGTGCCGCGGAAACCGATGTGGAAGACCCCGAGGTGGAGTGTGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223562 representing NM_130384
Red=Cloning site Green=Tags(s)

MAGTSAPGSKRRSEPPAPRPGPPPGTGHPPSKRARGFSAAAAPDPDDPFGAHGDFTADDLEELDTLASQA
LSQCPAAARDVSSDHKVHRLLDGMSKNPSGKNRETVPIKDNFELEVLQAQYKELKEKMKVMEEEVLIKNG
EIKILRDSLHQTESVLEEQRRSHFLLEQEKTQALSDKEKEFSKKLQSLQSELQFKDAEMNELRTKLQTSE
RANKLAAPSVSHVSPRKNPSVVIKPEACSPQFGKTSFPTKESFSANMSLPHPCQTESGYKPLVGREDSKP
HSLRGDSIKQEEAQKSFVDSWRQRSNTQGSILINLLLKQPLIPGSSLSLCHLLSSSSESPAGTPLQPPGF
GSTLAGMSGLRTTGSYDGSFSLSALREAQNLAFTGLNLVARNECSRDGDPAEGGRRAFPLCQLPGAVHFL
PLVQFFIGLHCQALQDLAAAKRSGAPGDSPTHSSCVSSGVETNPEDSVCILEGFSVTALSILQHLVCHSG
AVVSLLLSGVGADSAAGEGNRSLVHRLSDGDMTSALRGVADDQGQHPLLKMLLHLLAFSSAATGHLQASV
LTQCLKVLVKLAENTSCDFLPRFQCVFQVLPKCLSPETPLPSVLLAVELLSLLADHDQLAPQLCSHSEGC
LLLLLYMYITSRPDRVALETQWLQLEQEVVWLLAKLGVQSPLPPVTGSNCQCNVEVVRALTVMLHRQWLT
VRRAGGPPRTDQQRRTVRCLRDTVLLLHGLSQKDKLFMMHCVEVLHQFDQVMPGVSMLIRGLPDVTDCEE
AALDDLCAAETDVEDPEVECG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_130384
ORF Size 2373 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_130384.1, NM_130384.2, NP_569055.1
RefSeq Size 2509 bp
RefSeq ORF 2376 bp
Locus ID 84126
Cytogenetics 3p21.31
MW 85.7 kDa
Gene Summary This gene encodes an essential component of the DNA damage checkpoint. The encoded protein binds to single-stranded DNA coated with replication protein A. The protein also interacts with the ataxia telangiectasia and Rad3 related protein kinase, resulting in its accumulation at intranuclear foci induced by DNA damage. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2012]

Citations (2)

Other Versions

Other products for "ATRIP"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ATRIP mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools