PUF60 (NM_078480) Human Tagged ORF Clone

CAT#: RC223492

Reviews ()
Write a review

PUF60 (Myc-DDK-tagged)-Human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1



  "NM_078480" in other vectors (4)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PUF60
Synonyms FIR; RoBPI; SIAHBP1; VRJS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223492 representing NM_078480.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGCGACGGCGACCATAGCTCTCGTCAATGGCCAGCAAGGAGGGGGGTCCGAGCCGGCGGCGGCGGCG
GCAGTGGTGGCAGCGGGAGACAAATGGAAACCTCCACAGGGCACAGACTCCATCAAGATGGAGAACGGG
CAGAGCACAGCCGCCAAGCTGGGGCTGCCTCCCCTGACGCCCGAGCAGCAGGAGGCCCTTCAGAAGGCC
AAGAAGTACGCCATGGAGCAGAGCATCAAGAGTGTGCTGGTGAAGCAGACCATCGCGCACCAGCAGCAG
CAGCTCACCAACCTGCAGATGGCAGCAGTGACAATGGGCTTTGGAGATCCTCTCTCACCTTTGCAATCG
ATGGCGGCTCAGCGGCAGCGGGCGCTGGCCATCATGTGCCGCGTCTACGTGGGCTCTATCTACTATGAG
CTGGGGGAGGACACCATCCGCCAGGCCTTTGCCCCCTTTGGCCCCATCAAGAGCATCGACATGTCCTGG
GACTCCGTCACCATGAAGCACAAGGGCTTTGCCTTCGTGGAGTATGAGGTCCCCGAAGCTGCACAGCTG
GCCTTGGAGCAGATGAACTCGGTGATGCTGGGGGGCAGGAACATCAAGGTGGGCAGACCCAGCAACATA
GGGCAGGCCCAGCCCATCATAGACCAGTTGGCTGAGGAGGCACGGGCCTTCAACCGCATCTACGTGGCC
TCTGTGCACCAGGACCTCTCAGACGATGACATCAAGAGCGTGTTTGAGGCCTTTGGCAAGATCAAGTCC
TGCACACTGGCCCGGGACCCCACAACTGGCAAGCACAAGGGCTACGGCTTCATTGAGTACGAGAAGGCC
CAGTCGTCCCAAGATGCTGTGTCTTCCATGAACCTCTTTGACCTGGGTGGCCAGTACTTGCGGGTGGGC
AAGGCTGTCACACCGCCCATGCCCCTACTCACACCAGCCACGCCTGGAGGCCTCCCACCTGCCGCTGCT
GTGGCAGCTGCTGCAGCCACTGCCAAGATCACAGCTCAGGAAGCAGTGGCCGGAGCAGCGGTGCTGGGT
ACCCTGGGCACACCTGGACTGGTGTCCCCAGCACTGACCCTGGCCCAGCCCCTGGGCACTTTGCCCCAG
GCTGTCATGGCTGCCCAGGCACCTGGAGTCATCACAGGTGTGACCCCAGCCCGTCCTCCTATCCCGGTC
ACCATCCCCTCGGTGGGAGTGGTGAACCCCATCCTGGCCAGCCCTCCAACGCTGGGTCTCCTGGAGCCC
AAGAAGGAGAAGGAAGAAGAGGAGCTGTTTCCCGAGTCAGAGCGGCCAGAGATGCTGAGCGAGCAGGAG
CACATGAGCATCTCGGGCAGTAGCGCCCGACACATGGTGATGCAGAAGCTGCTCCGCAAGCAGGAGTCT
ACAGTGATGGTTCTGCGCAACATGGTGGACCCCAAGGACATCGATGATGACCTGGAAGGGGAGGTGACA
GAGGAGTGTGGCAAGTTCGGGGCCGTGAACCGCGTCATCATCTACCAAGAGAAACAAGGCGAGGAGGAG
GATGCAGAAATCATTGTCAAGATCTTTGTGGAGTTTTCCATAGCCTCTGAGACTCATAAGGCCATCCAG
GCCCTCAATGGCCGCTGGTTTGCTGGCCGCAAGGTGGTGGCTGAAGTGTACGACCAGGAGCGTTTTGAT
AACAGTGACCTCTCTGCG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>Peptide sequence encoded by RC223492
Blue=ORF Red=Cloning site Green=Tag(s)

MATATIALVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKA
KKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQRQRALAIMCRVYVGSIYYE
LGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNI
GQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKA
QSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLG
TLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEP
KKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVT
EECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFD
NSDLSA

myc-FLAG tag

Recombinant protein using RC223492 also available, TP323492
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_078480
ORF Size 1674 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq Size 1946 bp
RefSeq ORF 1680 bp
Locus ID 22827
UniProt ID Q9UHX1
Cytogenetics 8q24.3
Domains RRM, RRM_1
Protein Pathways Spliceosome
MW 59.7 kDa
Gene Summary This gene encodes a nucleic acid-binding protein that plays a role in a variety of nuclear processes, including pre-mRNA splicing and transcriptional regulation. The encoded protein forms a complex with the far upstream DNA element (FUSE) and FUSE-binding protein at the myelocytomatosis oncogene (MYC) promoter. This complex represses MYC transcription through the core-TFIIH basal transcription factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]

Other Versions

Other products for "PUF60"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-PUF60 Antibody
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.