AP2S1 (NM_021575) Human Tagged ORF Clone

CAT#: RC223424

AP2S1 (Myc-DDK-tagged)-Human adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant AP17delta

Product Images

Circular map for RC223424

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: AP2S1
• Synonyms: AP17; CLAPS2; FBH3; FBHOk; HHC3
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC223424 representing NM_021575
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGATCCGCTTTATCCTCATCCAGAACCGGGCAGGCAAGACGCGCCTGGCCAAGTGGTACATGCAGTTTG
  ATGATGATGAGAAACAGAAGCTGATCGAGGAGGTGCATGCCGTGGTCACCGTCCGAGACGCCAAACACAC
  CAACTTTGTGGAGGTCTTAAACGAATATTTCCACAATGTCTGTGAACTGGACCTGGTGTTCAACTTCTAC
  AAGGTTTACACGGTCGTGGACGAGATGTTCCTGGCTGGCGAAATCCGAGAGACCAGCCAGACGAAGGTGC
  TGAAACAGCTGCTGATGCTACAGTCCCTGGAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC223424 representing NM_021575
  Red=Cloning site Green=Tags(s)
  
  MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEVLNEYFHNVCELDLVFNFY
  KVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_021575
• ORF Size: 312 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_021575.4
• RefSeq Size: 851 bp
• RefSeq ORF: 315 bp
• Locus ID: 1175
• UniProt ID: P53680
• Cytogenetics: 19q13.32
• Domains: Clat_adaptor_s
• Protein Pathways: Endocytosis, Huntington's disease
• MW: 12.4 kDa
• Gene Summary: One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]