EP300(EP300) (NM_001429) Human Tagged ORF Clone

CAT#: RC223265

EP300 (Myc-DDK-tagged)-Human E1A binding protein p300 (EP300)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name EP300(EP300) (NM_001429) Human Tagged ORF Clone
Symbol EP300
Synonyms KAT3B; p300; RSTS2
Vector pCMV6-Entry
Sequence Data
>RC223265 representing NM_001429
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAGAATGTGGTGGAACCGGGGCCGCCTTCAGCCAAGCGGCCTAAACTCTCATCTCCGGCCCTCT
CGGCGTCCGCCAGCGATGGCACAGATTTTGGCTCTCTATTTGACTTGGAGCACGACTTACCAGATGAATT
AATCAACTCTACAGAATTGGGACTAACCAATGGTGGTGATATTAATCAGCTTCAGACAAGTCTTGGCATG
GTACAAGATGCAGCTTCTAAACATAAACAGCTGTCAGAATTGCTGCGATCTGGTAGTTCCCCTAACCTCA
ATATGGGAGTTGGTGGCCCAGGTCAAGTCATGGCCAGCCAGGCCCAACAGAGCAGTCCTGGATTAGGTTT
GATAAATAGCATGGTCAAAAGCCCAATGACACAGGCAGGCTTGACTTCTCCCAACATGGGGATGGGCACT
AGTGGACCAAATCAGGGTCCTACGCAGTCAACAGGTATGATGAACAGTCCAGTAAATCAGCCTGCCATGG
GAATGAACACAGGGATGAATGCGGGCATGAATCCTGGAATGTTGGCTGCAGGCAATGGACAAGGGATAAT
GCCTAATCAAGTCATGAACGGTTCAATTGGAGCAGGCCGAGGGCGACAGAATATGCAGTACCCAAACCCA
GGCATGGGAAGTGCTGGCAACTTACTGACTGAGCCTCTTCAGCAGGGCTCTCCCCAGATGGGAGGACAAA
CAGGATTGAGAGGCCCCCAGCCTCTTAAGATGGGAATGATGAACAACCCCAATCCTTATGGTTCACCATA
TACTCAGAATCCTGGACAGCAGATTGGAGCCAGTGGCCTTGGTCTCCAGATTCAGACAAAAACTGTACTA
TCAAATAACTTATCTCCATTTGCTATGGACAAAAAGGCAGTTCCTGGTGGAGGAATGCCCAACATGGGTC
AACAGCCAGCCCCGCAGGTCCAGCAGCCAGGCCTGGTGACTCCAGTTGCCCAAGGGATGGGTTCTGGAGC
ACATACAGCTGATCCAGAGAAGCGCAAGCTCATCCAGCAGCAGCTTGTTCTCCTTTTGCATGCTCACAAG
TGCCAGCGCCGGGAACAGGCCAATGGGGAAGTGAGGCAGTGCAACCTTCCCCACTGTCGCACAATGAAGA
ATGTCCTAAACCACATGACACACTGCCAGTCAGGCAAGTCTTGCCAAGTGGCACACTGTGCATCTTCTCG
ACAAATCATTTCACACTGGAAGAATTGTACAAGACATGATTGTCCTGTGTGTCTCCCCCTCAAAAATGCT
GGTGATAAGAGAAATCAACAGCCAATTTTGACTGGAGCACCCGTTGGACTTGGAAATCCTAGCTCTCTAG
GGGTGGGTCAACAGTCTGCCCCCAACCTAAGCACTGTTAGTCAGATTGATCCCAGCTCCATAGAAAGAGC
CTATGCAGCTCTTGGACTACCCTATCAAGTAAATCAGATGCCGACACAACCCCAGGTGCAAGCAAAGAAC
CAGCAGAATCAGCAGCCTGGGCAGTCTCCCCAAGGCATGCGGCCCATGAGCAACATGAGTGCTAGTCCTA
TGGGAGTAAATGGAGGTGTAGGAGTTCAAACGCCGAGTCTTCTTTCTGACTCAATGTTGCATTCAGCCAT
AAATTCTCAAAACCCAATGATGAGTGAAAATGCCAGTGTGCCCTCCCTGGGTCCTATGCCAACAGCAGCT
CAACCATCCACTACTGGAATTCGGAAACAGTGGCACGAAGATATTACTCAGGATCTTCGAAATCATCTTG
TTCACAAACTCGTCCAAGCCATATTTCCTACGCCGGATCCTGCTGCTTTAAAAGACAGACGGATGGAAAA
CCTAGTTGCATATGCTCGGAAAGTTGAAGGGGACATGTATGAATCTGCAAACAATCGAGCGGAATACTAC
CACCTTCTAGCTGAGAAAATCTATAAGATCCAGAAAGAACTAGAAGAAAAACGAAGGACCAGACTACAGA
AGCAGAACATGCTACCAAATGCTGCAGGCATGGTTCCAGTTTCCATGAATCCAGGGCCTAACATGGGACA
GCCGCAACCAGGAATGACTTCTAATGGCCCTCTACCTGACCCAAGTATGATCCGTGGCAGTGTGCCAAAC
CAGATGATGCCTCGAATAACTCCACAATCTGGTTTGAATCAATTTGGCCAGATGAGCATGGCCCAGCCCC
CTATTGTACCCCGGCAAACCCCTCCTCTTCAGCACCATGGACAGTTGGCTCAACCTGGAGCTCTCAACCC
GCCTATGGGCTATGGGCCTCGTATGCAACAGCCTTCCAACCAGGGCCAGTTCCTTCCTCAGACTCAGTTC
CCATCACAGGGAATGAATGTAACAAATATCCCTTTGGCTCCGTCCAGCGGTCAAGCTCCAGTGTCTCAAG
CACAAATGTCTAGTTCTTCCTGCCCGGTGAACTCTCCTATAATGCCTCCAGGGTCTCAGGGGAGCCACAT
TCACTGTCCCCAGCTTCCTCAACCAGCTCTTCATCAGAATTCACCCTCGCCTGTACCTAGTCGTACCCCC
ACCCCTCACCATACTCCCCCAAGCATAGGGGCTCAGCAGCCACCAGCAACAACAATTCCAGCCCCTGTTC
CTACACCTCCTGCCATGCCACCTGGGCCACAGTCCCAGGCTCTACATCCCCCTCCAAGGCAGACACCTAC
ACCACCAACAACACAACTTCCCCAACAAGTGCAGCCTTCACTTCCTGCTGCACCTTCTGCTGACCAGCCC
CAGCAGCAGCCTCGCTCACAGCAGAGCACAGCAGCGTCTGTTCCTACCCCAACAGCACCGCTGCTTCCTC
CGCAGCCTGCAACTCCACTTTCCCAGCCAGCTGTAAGCATTGAAGGACAGGTATCAAATCCTCCATCTAC
TAGTAGCACAGAAGTGAATTCTCAGGCCATTGCTGAGAAGCAGCCTTCCCAGGAAGTGAAGATGGAGGCC
AAAATGGAAGTGGATCAACCAGAACCAGCAGATACTCAGCCGGAGGATATTTCAGAGTCTAAAGTGGAAG
ACTGTAAAATGGAATCTACCGAAACAGAAGAGAGAAGCACTGAGTTAAAAACTGAAATAAAAGAGGAGGA
AGACCAGCCAAGTACTTCAGCTACCCAGTCATCTCCGGCTCCAGGACAGTCAAAGAAAAAGATTTTCAAA
CCAGAAGAACTACGACAGGCACTGATGCCAACTTTGGAGGCACTTTACCGTCAGGATCCAGAATCCCTTC
CCTTTCGTCAACCTGTGGACCCTCAGCTTTTAGGAATCCCTGATTACTTTGATATTGTGAAGAGCCCCAT
GGATCTTTCTACCATTAAGAGGAAGTTAGACACTGGACAGTATCAGGAGCCCTGGCAGTATGTCGATGAT
ATTTGGCTTATGTTCAATAATGCCTGGTTATATAACCGGAAAACATCACGGGTATACAAATACTGCTCCA
AGCTCTCTGAGGTCTTTGAACAAGAAATTGACCCAGTGATGCAAAGCCTTGGATACTGTTGTGGCAGAAA
GTTGGAGTTCTCTCCACAGACACTGTGTTGCTACGGCAAACAGTTGTGCACAATACCTCGTGATGCCACT
TATTACAGTTACCAGAACAGGTATCATTTCTGTGAGAAGTGTTTCAATGAGATCCAAGGGGAGAGCGTTT
CTTTGGGGGATGACCCTTCCCAGCCTCAAACTACAATAAATAAAGAACAATTTTCCAAGAGAAAAAATGA
CACACTGGATCCTGAACTGTTTGTTGAATGTACAGAGTGCGGAAGAAAGATGCATCAGATCTGTGTCCTT
CACCATGAGATCATCTGGCCTGCTGGATTCGTCTGTGATGGCTGTTTAAAGAAAAGTGCACGAACTAGGA
AAGAAAATAAGTTTTCTGCTAAAAGGTTGCCATCTACCAGACTTGGCACCTTTCTAGAGAATCGTGTGAA
TGACTTTCTGAGGCGACAGAATCACCCTGAGTCAGGAGAGGTCACTGTTAGAGTAGTTCATGCTTCTGAC
AAAACCGTGGAAGTAAAACCAGGCATGAAAGCAAGGTTTGTGGACAGTGGAGAGATGGCAGAATCCTTTC
CATACCGAACCAAAGCCCTCTTTGCCTTTGAAGAAATTGATGGTGTTGACCTGTGCTTCTTTGGCATGCA
TGTTCAAGAGTATGGCTCTGACTGCCCTCCACCCAACCAGAGGAGAGTATACATATCTTACCTCGATAGT
GTTCATTTCTTCCGTCCTAAATGCTTGAGGACTGCAGTCTATCATGAAATCCTAATTGGATATTTAGAAT
ATGTCAAGAAATTAGGTTACACAACAGGGCATATTTGGGCATGTCCACCAAGTGAGGGAGATGATTATAT
CTTCCATTGCCATCCTCCTGACCAGAAGATACCCAAGCCCAAGCGACTGCAGGAATGGTACAAAAAAATG
CTTGACAAGGCTGTATCAGAGCGTATTGTCCATGACTACAAGGATATTTTTAAACAAGCTACTGAAGATA
GATTAACAAGTGCAAAGGAATTGCCTTATTTCGAGGGTGATTTCTGGCCCAATGTTCTGGAAGAAAGCAT
TAAGGAACTGGAACAGGAGGAAGAAGAGAGAAAACGAGAGGAAAACACCAGCAATGAAAGCACAGATGTG
ACCAAGGGAGACAGCAAAAATGCTAAAAAGAAGAATAATAAGAAAACCAGCAAAAATAAGAGCAGCCTGA
GTAGGGGCAACAAGAAGAAACCCGGGATGCCCAATGTATCTAACGACCTCTCACAGAAACTATATGCCAC
CATGGAGAAGCATAAAGAGGTCTTCTTTGTGATCCGCCTCATTGCTGGCCCTGCTGCCAACTCCCTGCCT
CCCATTGTTGATCCTGATCCTCTCATCCCCTGCGATCTGATGGATGGTCGGGATGCGTTTCTCACGCTGG
CAAGGGACAAGCACCTGGAGTTCTCTTCACTCCGAAGAGCCCAGTGGTCCACCATGTGCATGCTGGTGGA
GCTGCACACGCAGAGCCAGGACCGCTTTGTCTACACCTGCAATGAATGCAAGCACCATGTGGAGACACGC
TGGCACTGTACTGTCTGTGAGGATTATGACTTGTGTATCACCTGCTATAACACTAAAAACCATGACCACA
AAATGGAGAAACTAGGCCTTGGCTTAGATGATGAGAGCAACAACCAGCAGGCTGCAGCCACCCAGAGCCC
AGGCGATTCTCGCCGCCTGAGTATCCAGCGCTGCATCCAGTCTCTGGTCCATGCTTGCCAGTGTCGGAAT
GCCAATTGCTCACTGCCATCCTGCCAGAAGATGAAGCGGGTTGTGCAGCATACCAAGGGTTGCAAACGGA
AAACCAATGGCGGGTGCCCCATCTGCAAGCAGCTCATTGCCCTCTGCTGCTACCATGCCAAGCACTGCCA
GGAGAACAAATGCCCGGTGCCGTTCTGCCTAAACATCAAGCAGAAGCTCCGGCAGCAACAGCTGCAGCAC
CGACTACAGCAGGCCCAAATGCTTCGCAGGAGGATGGCCAGCATGCAGCGGACTGGTGTGGTTGGGCAGC
AACAGGGCCTCCCTTCCCCCACTCCTGCCACTCCAACGACACCAACTGGCCAACAGCCAACCACCCCGCA
GACGCCCCAGCCCACTTCTCAGCCTCAGCCTACCCCTCCCAATAGCATGCCACCCTACTTGCCCAGGACT
CAAGCTGCTGGCCCTGTGTCCCAGGGTAAGGCAGCAGGCCAGGTGACCCCTCCAACCCCTCCTCAGACTG
CTCAGCCACCCCTTCCAGGGCCCCCACCTGCAGCAGTGGAAATGGCAATGCAGATTCAGAGAGCAGCGGA
GACGCAGCGCCAGATGGCCCACGTGCAAATTTTTCAAAGGCCAATCCAACACCAGATGCCCCCGATGACT
CCCATGGCCCCCATGGGTATGAACCCACCTCCCATGACCAGAGGTCCCAGTGGGCATTTGGAGCCAGGGA
TGGGACCGACAGGGATGCAGCAACAGCCACCCTGGAGCCAAGGAGGATTGCCTCAGCCCCAGCAACTACA
GTCTGGGATGCCAAGGCCAGCCATGATGTCAGTGGCCCAGCATGGTCAACCTTTGAACATGGCTCCACAA
CCAGGATTGGGCCAGGTAGGTATCAGCCCACTCAAACCAGGCACTGTGTCTCAACAAGCCTTACAAAACC
TTTTGCGGACTCTCAGGTCTCCCAGCTCTCCCCTGCAGCAGCAACAGGTGCTTAGTATCCTTCACGCCAA
CCCCCAGCTGTTGGCTGCATTCATCAAGCAGCGGGCTGCCAAGTATGCCAACTCTAATCCACAACCCATC
CCTGGGCAGCCTGGCATGCCCCAGGGGCAGCCAGGGCTACAGCCACCTACCATGCCAGGTCAGCAGGGGG
TCCACTCCAATCCAGCCATGCAGAACATGAATCCAATGCAGGCGGGCGTTCAGAGGGCTGGCCTGCCCCA
GCAGCAACCACAGCAGCAACTCCAGCCACCCATGGGAGGGATGAGCCCCCAGGCTCAGCAGATGAACATG
AACCACAACACCATGCCTTCACAATTCCGAGACATCTTGAGACGACAGCAAATGATGCAACAGCAGCAGC
AACAGGGAGCAGGGCCAGGAATAGGCCCTGGAATGGCCAACCATAACCAGTTCCAGCAACCCCAAGGAGT
TGGCTACCCACCACAGCAGCAGCAGCGGATGCAGCATCACATGCAACAGATGCAACAAGGAAATATGGGA
CAGATAGGCCAGCTTCCCCAGGCCTTGGGAGCAGAGGCAGGTGCCAGTCTACAGGCCTATCAGCAGCGAC
TCCTTCAGCAACAGATGGGGTCCCCTGTTCAGCCCAACCCCATGAGCCCCCAGCAGCATATGCTCCCAAA
TCAGGCCCAGTCCCCACACCTACAAGGCCAGCAGATCCCTAATTCTCTCTCCAATCAAGTGCGCTCTCCC
CAGCCTGTCCCTTCTCCACGGCCACAGTCCCAGCCCCCCCACTCCAGTCCTTCCCCAAGGATGCAGCCTC
AGCCTTCTCCACACCACGTTTCCCCACAGACAAGTTCCCCACATCCTGGACTGGTAGCTGCCCAGGCCAA
CCCCATGGAACAAGGGCATTTTGCCAGCCCGGACCAGAATTCAATGCTTTCTCAGCTTGCTAGCAATCCA
GGCATGGCAAACCTCCATGGTGCAAGCGCCACGGACCTGGGACTCAGCACCGATAACTCAGACTTGAATT
CAAACCTCTCACAGAGTACACTAGACATACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223265 representing NM_001429
Red=Cloning site Green=Tags(s)

MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGM
VQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGT
SGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNP
GMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVL
SNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHK
CQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKN
QQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAA
QPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYY
HLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPN
QMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQF
PSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQP
QQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEA
KMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFK
PEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDD
IWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAT
YYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASD
KTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDS
VHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKM
LDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDV
TKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLP
PIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRN
ANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQH
RLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRT
QAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMT
PMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQ
PGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPI
PGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNM
NHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMG
QIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSP
QPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNP
GMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001429
ORF Size 7242 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001429.1, NM_001429.2, NM_001429.3, NP_001420
RefSeq Size 8765
RefSeq ORF 7245
Locus ID 2033
Cytogenetics 22q13.2
Domains zf-TAZ, ZnF_ZZ, BROMO, KIX
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Cell cycle, Wnt signaling pathway, Notch signaling pathway, TGF-beta signaling pathway, Adherens junction, Jak-STAT signaling pathway, Long-term potentiation, Melanogenesis, Huntington's disease, Pathways in cancer, Renal cell carcinoma, Prostate cancer
MW 264 kDa
Gene Summary This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)