C10orf90 (NM_001004298) Human Tagged ORF Clone

CAT#: RC223255

C10orf90 (Myc-DDK-tagged)-Human chromosome 10 open reading frame 90 (C10orf90)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name C10orf90 (NM_001004298) Human Tagged ORF Clone
Symbol C10orf90
Synonyms bA422P15.2; FATS
Vector pCMV6-Entry
Sequence Data
>RC223255 representing NM_001004298
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCAAACTGTCTGGAGAAGGATTACGGGACAGCTACCACAGTAGAAGAGATCAAATTGCCCTTAAAA
ATCTCCAGTCTGATGTCACAGAGGCAAAATCTGACTTCACCAAGGAGACCCTGGCATCACAAAACACAAA
AATGATTTCATCCATAGTCATCTCCCAGATGATTGATGAGAATAAGTCAAGAGAAAACAGGGCCTCCTTG
CCCCTACCGTGTGCCATTGCTCAGTCTCGTGCACATCACGCCAAGCAATCTCTGGCTAACCGCAGCGGAG
TCAACATTCACAGAGCATTTGCGTTACTTCCGGGCAGATTAGGAATCCCGGCACCGTCAGATGAGCGAGG
ACCTGAGGCAGAGCTGCCGCCCAAAGAGGAGAGACCCTGTGGGGGCCCCCGCAGAGGGTTTGCATCCATC
ACCATCACGGCCAGACGCGTGGGCCCCCCAGCCCGCGCCCTGGTGTGGGGGACTGCTGGGGACTCTCTGT
GCCCCAAGTGCAGGGCTGAGGACACACTGTTCCAGGCGCCCCCGGCTCTGGCCAATGGCGCCCATCCAGG
TCGGCATCAGAGATCTTTTGCCTGCACAGAGTTCTCCAGAAACAGCTCCGTGGTGCGGCTGAAGGTTCCC
GAGGCCCACACTGGGTTGTGTGAGAGACGCAAGTACTGGGTCACCCATGCAGACGACAAAGAGACCAGTT
TTTCTCCAGACACCCCACTGTCAGGAAAGAGCCCGCTGGTGTTCAGTTCCTGTGTCCACCTCAGGGTGTC
TCAGCAGTGTCCAGATTCAATCTATTACGTAGACAAGTCTCTCTCCGTCCCCATTGAGCCACCTCAAATT
GCCAGCCCCAAAATGCACAGATCCGTCCTGTCGCTCAACCTCAATTGTAGTTCCCACAGATTAACAGCAG
ATGGAGTAGATGGCCTAGTGAACAGAGAGCCAATAAGCGAAGCCCTGAAGCAGGAGCTCCTGGAGGGAGA
CCAGGACCTCGTAGGCCAGCGCTGGAACCCAGGTTTACAAGAAAGTCACTTGAAGGAAACCCCATCGTTG
AGGCGGGTGCATTTGGGGACCGGCGCTTGTCCTTGGAGTGGTTCTTTTCCATTGGAAAACACAGAATTGG
CAAATGTGGGAGCTAACCAAGTCACTGTAAGAAAAGGGGAAAAGGACCATACAACTCATTGTCACGCCAG
CGATCATGCCAACCAACTGTCCATTCACATTCCTGGCTGGAGTTACAGGGCAGTACACACAAAAGTATTT
TCTGGAAGCAGCAAGAGGCAACAAGGAGAAGTATGTATGACTGTGTCTGCTCCTCCAGTGGAACAGAAGC
CCACTAGACATTTCCTTCCCATTGGGGATAGCTCTCCAAGCGATGACTGTCTGTCTAGAGACCTTTCTGA
GCCCACAGAGAGACGACATCAAAGCTTCCTGAAACCCAGAATCCTTTTTCCTGGGTTTCTTTGCCCCTTA
CAAGATGTATGTGCATCTCTGCAGGAAGACAATGGTGTTCAGATAGAAAGCAAGTTCCCCAAAGGAGATT
ACACATGCTGTGACTTGGTTGTAAAAATAAAGGAATGTAAGAAGAGTGAGGACCCCACCACACCTGAGCC
CTCCCCAGCAGCACCCTCGCCAGCACCCCGCGATGGAGCAGGGAGCCCTGGCCTGTCCGAAGACTGTTCT
GAGTCTCAGCAAACGCCTGCAAGATCTTTGACCTTGCAAGAAGCACTGGAAGTTCGTAAGCCTCAGTTCA
TTTCTCGCTCACAAGAACGGCTGAAGAAGCTTGAACACATGGTCCAGCAGAGGAAAGCCCAGCGGAAGGA
GGACCTGAGGCAGAAGCAGAGCCTCCTTCCCATCCGCACCAGCAAGAAGCAGTTCACGATTCCCCATCCT
CTGAGTGATAACTTGTTCAAACCCAAAGAACGGTGCATTTCAGAGAAGGAGATGCATATGCGATCTAAGA
GAATCTATGATAACTTGCCGGAAGTTAAAAAGAAAAAAGAAGAACAAAGGAAAAGGGTGATCTTACAAAG
TAACAGACTCCGTGCCGAAGTCTTCAAAAAGCAATTACTGGACCAGCTCCTTCAAAGGAATGCGGTC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC223255 representing NM_001004298
Red=Cloning site Green=Tags(s)

MLKLSGEGLRDSYHSRRDQIALKNLQSDVTEAKSDFTKETLASQNTKMISSIVISQMIDENKSRENRASL
PLPCAIAQSRAHHAKQSLANRSGVNIHRAFALLPGRLGIPAPSDERGPEAELPPKEERPCGGPRRGFASI
TITARRVGPPARALVWGTAGDSLCPKCRAEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVP
EAHTGLCERRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPDSIYYVDKSLSVPIEPPQI
ASPKMHRSVLSLNLNCSSHRLTADGVDGLVNREPISEALKQELLEGDQDLVGQRWNPGLQESHLKETPSL
RRVHLGTGACPWSGSFPLENTELANVGANQVTVRKGEKDHTTHCHASDHANQLSIHIPGWSYRAVHTKVF
SGSSKRQQGEVCMTVSAPPVEQKPTRHFLPIGDSSPSDDCLSRDLSEPTERRHQSFLKPRILFPGFLCPL
QDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPAAPSPAPRDGAGSPGLSEDCS
ESQQTPARSLTLQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLPIRTSKKQFTIPHP
LSDNLFKPKERCISEKEMHMRSKRIYDNLPEVKKKKEEQRKRVILQSNRLRAEVFKKQLLDQLLQRNAV

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001004298
ORF Size 2097 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001004298.2, NP_001004298
RefSeq Size 3097
RefSeq ORF 2100
Locus ID 118611
Cytogenetics 10q26.2
MW 77.7 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)