BOULE (BOLL) (NM_197970) Human Tagged ORF Clone

CAT#: RC223217

Reviews ()
Write a review

BOLL (Myc-DDK-tagged)-Human bol, boule-like (Drosophila) (BOLL), transcript variant 1



  "NM_197970" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BOULE (BOLL) (NM_197970) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BOLL
Synonyms BOULE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC223217 representing NM_197970
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAACCGAGTCCGGGCCGCAAACATCAAACCAGATGCAAACAGATTCATTATCTCCATCCCCTAATC
CTGTGTCACCTGTGCCTTTGAATAACCCAACAAGTGCCCCAAGATATGGAACAGTGATCCCTAATCGCAT
CTTTGTAGGAGGAATTGATTTTAAGACAAACGAAAGTGATTTAAGAAAATTTTTTTCCCAGTATGGGTCT
GTGAAAGAAGTGAAGATTGTAAATGACAGAGCTGGAGTATCCAAAGGGTATGGTTTCGTCACTTTTGAAA
CACAAGAAGATGCACAAAAAATTTTACAAGAGGCTGAAAAACTTAATTATAAGGATAAGAAGCTGAACAT
TGGTCCAGCAATAAGAAAACAACAAGTAGGGATCCCTCGTTCTAGTATAATGCCAGCAGCTGGAACAATG
TATCTAACAACTTCAACTGGATATCCTTATACTTACCATAATGGTGTTGCTTATTTTCATACTCCAGAGG
TAACTTCGGTCCCACCGCCTTGGCCTTCACGTTCTGTATGTAGCTCCCCTGTGATGGTAGCTCAGCCCAT
TTATCAGCAACCTGCATATCACTACCAGGCCACCACACAGTATTTACCAGGACAGTGGCAGTGGAGTGTT
CCTCAGCCTTCTGCCTCTTCTGCTCCATTCTTATACCTGCAACCTTCTGAGGTTATTTATCAACCAGTGG
AAATTGCACAGGATGGTGGATGTGTTCCTCCTCCACTGTCTCTGATGGAAACTTCAGTTCCAGAGCCTTA
TTCTGATCATGGAGTTCAAGCAACATATCACCAGGTTTATGCTCCAAGTGCCATCACTATGCCTGCGCCT
GTGATGCAGCCTGAGCCAATTAAAACAGTGTGGAGCATTCATTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223217 representing NM_197970
Red=Cloning site Green=Tags(s)

METESGPQTSNQMQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGS
VKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTM
YLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSV
PQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAP
VMQPEPIKTVWSIHY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_197970
ORF Size 885 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_197970.1, NM_197970.2, NP_932074.1
RefSeq Size 2804 bp
RefSeq ORF 888 bp
Locus ID 66037
Cytogenetics 2q33.1
MW 32.4 kDa
Gene Summary This gene belongs to the DAZ gene family required for germ cell development. It encodes an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "BOLL"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


BOLL mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools