ECE1 (NM_001397) Human Tagged ORF Clone

CAT#: RC223135

Reviews ()
Write a review

ECE1 (Myc-DDK-tagged)-Human endothelin converting enzyme 1 (ECE1), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ECE1
Synonyms ECE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223135 representing NM_001397
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGGGCGTGTGGCCGCCCCCGGTGTCCGCCCTGCTGTCGGCGCTGGGGATGTCGACGTACAAGCGGG
CCACGCTGGACGAGGAGGACCTGGTGGACTCGCTCTCCGAGGGCGACGCATACCCCAACGGCCTGCAGGT
GAACTTCCACAGCCCCCGGAGTGGCCAGAGGTGCTGGGCTGCACGGACCCAGGTGGAGAAGCGGCTGGTG
GTGTTGGTGGTACTTCTGGCGGCAGGACTGGTGGCCTGCTTGGCAGCACTGGGCATCCAGTACCAGACAA
GATCCCCCTCTGTGTGCCTGAGCGAAGCTTGTGTCTCAGTGACCAGCTCCATCTTGAGCTCCATGGACCC
CACAGTGGACCCCTGCCATGACTTCTTCAGCTACGCCTGTGGGGGCTGGATCAAGGCCAACCCAGTCCCT
GATGGCCACTCACGCTGGGGGACCTTCAGCAACCTCTGGGAACACAACCAAGCAATCATCAAGCACCTCC
TCGAAAACTCCACGGCCAGCGTGAGCGAGGCAGAGAGAAAGGCGCAAGTATACTACCGTGCGTGCATGAA
CGAGACCAGGATCGAGGAGCTCAGGGCCAAACCTCTAATGGAGTTGATTGAGAGGCTCGGGGGCTGGAAC
ATCACAGGTCCCTGGGCCAAGGACAACTTCCAGGACACCCTGCAGGTGGTCACCGCCCACTACCGCACCT
CACCCTTCTTCTCTGTCTATGTCAGTGCCGATTCCAAGAACTCCAACAGCAACGTGATCCAGGTGGACCA
GTCTGGCCTGGGCTTGCCCTCGAGAGACTATTACCTGAACAAAACTGAAAACGAGAAGGTGCTGACCGGA
TATCTGAACTACATGGTCCAGCTGGGGAAGCTGCTGGGCGGCGGGGACGAGGAGGCCATCCGGCCCCAGA
TGCAGCAGATCTTGGACTTTGAGACGGCACTGGCCAACATCACCATCCCACAGGAGAAGCGCCGTGATGA
GGAGCTCATCTACCACAAAGTGACGGCAGCCGAGCTGCAGACCTTGGCACCCGCCATCAACTGGTTGCCT
TTTCTCAACACCATCTTCTACCCCGTGGAGATCAATGAATCCGAGCCTATTGTGGTCTATGACAAGGAAT
ACCTTGAGCAGATCTCCACTCTCATCAACACCACCGACAGATGCCTGCTCAACAACTACATGATCTGGAA
CCTGGTGCGGAAAACAAGCTCCTTCCTTGACCAGCGCTTTCAGGACGCCGATGAGAAGTTCATGGAAGTC
ATGTACGGGACCAAGAAGACCTGTCTTCCTCGCTGGAAGTTTTGCGTGAGTGACACAGAAAACAACCTGG
GCTTTGCGTTGGGCCCCATGTTTGTCAAAGCAACCTTCGCCGAGGACAGCAAGAGCATAGCCACCGAGAT
CATCCTGGAGATTAAGAAGGCATTTGAGGAAAGCCTGAGCACCCTGAAGTGGATGGATGAGGAAACCCGA
AAATCAGCCAAGGAAAAGGCCGATGCCATCTACAACATGATAGGATACCCCAACTTCATCATGGATCCCA
AGGAGCTGGACAAAGTGTTTAATGACTACACTGCAGTTCCAGACCTCTACTTTGAAAATGCCATGCGGTT
TTTCAACTTCTCATGGAGGGTCACTGCCGATCAGCTCAGGAAAGCCCCCAACAGAGATCAGTGGAGCATG
ACCCCGCCCATGGTGAACGCCTACTACTCGCCCACCAAGAATGAGATTGTGTTTCCGGCCGGGATCCTGC
AGGCACCATTCTACACACGCTCCTCACCCAAGGCCTTAAACTTTGGTGGCATAGGTGTCGTCGTGGGCCA
TGAGCTGACTCATGCTTTTGATGATCAAGGACGGGAGTATGACAAGGACGGGAACCTCCGGCCATGGTGG
AAGAACTCATCCGTGGAGGCCTTCAAGCGTCAGACCGAGTGCATGGTAGAGCAGTACAGCAACTACAGCG
TGAACGGGGAGCCGGTGAACGGGCGGCACACCCTGGGGGAGAACATCGCCGACAACGGGGGTCTCAAGGC
GGCCTATCGGGCTTACCAGAACTGGGTGAAGAAGAACGGGGCTGAGCACTCGCTCCCCACCCTGGGCCTC
ACCAATAACCAGCTCTTCTTCCTGGGCTTTGCACAGGTCTGGTGCTCCGTCCGCACACCTGAGAGCTCCC
ACGAAGGCCTCATCACCGATCCCCACAGCCCCTCTCGCTTCCGGGTCATCGGCTCCCTCTCCAATTCCAA
GGAGTTCTCAGAACACTTCCGCTGCCCACCTGGCTCACCCATGAACCCGCCTCACAAGTGCGAAGTCTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223135 representing NM_001397
Red=Cloning site Green=Tags(s)

MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWAARTQVEKRLV
VLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVP
DGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWN
ITGPWAKDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTG
YLNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLP
FLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV
MYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLSTLKWMDEETR
KSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSM
TPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWW
KNSSVEAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGL
TNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001397
ORF Size 2310 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001397.3
RefSeq Size 2409 bp
RefSeq ORF 2313 bp
Locus ID 1889
UniProt ID P42892
Cytogenetics 1p36.12
Domains Peptidase_M13
Protein Families Druggable Genome, Protease, Transmembrane
MW 87 kDa
Gene Summary The protein encoded by this gene is involved in proteolytic processing of endothelin precursors to biologically active peptides. Mutations in this gene are associated with Hirschsprung disease, cardiac defects and autonomic dysfunction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Sep 2009]
Other products for "ECE1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.