EHM2(EPB41L4B) (NM_018424) Human Tagged ORF Clone

CAT#: RC223085

EPB41L4B (Myc-DDK-tagged)-Human erythrocyte membrane protein band 4.1 like 4B (EPB41L4B), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 660.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EHM2(EPB41L4B) (NM_018424) Human Tagged ORF Clone
Symbol EPB41L4B
Synonyms CG1; EHM2
Vector pCMV6-Entry
Sequence Data
>RC223085 representing NM_018424
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCGGTTCCTGCGCCGGACCTTTGGCCGCCGCTCCATGCAGCGCTACGCGCGGGGCGCGGCGGGGC
GCGGGGCCGCCGGGCTGGGGGACGAGCGCGATGGGGGGCCACGGGGGGGCCCGGCCGCCGCCGCCTCCTC
CTCGGCGCTGCCCGCCGCGCCCGGGGGCAGCGTGTTCCCGGCGGGCGGCGGGCCCCTGCTCACCGGCGGC
GCGGCCGTGCACATCTCCGCCGCCGGCGCCGCCAAGGCCACCCTCTACTGCCGCGTCTTCCTGCTCGACG
GGACCGAAGTGAGCGTGGACCTGCCGAAACATGCCAAAGGCCAGGATTTGTTTGATCAGATTGTGTACCA
CTTGGACCTTGTGGAAACAGATTACTTTGGCCTCCAGTTCCTCGACTCTGCCCAGGTTGCGCACTGGCTG
GATCATGCCAAACCCATAAAAAAGCAGATGAAAATTGGACCTGCTTATGCTTTACACTTTCGAGTTAAAT
ACTATTCTTCAGAACCAAACAACCTTCGTGAGGAGTTTACAAGGTACCTGTTTGTTTTACAACTCAGGCA
TGACATTCTTTCTGGAAAATTGAAATGCCCTTATGAAACAGCTGTGGAATTAGCTGCTCTCTGTCTACAA
GCGGAGCTTGGGGAGTGCGAGCTTCCAGAACACACACCAGAGCTTGTGTCTGAGTTTCGGTTCATTCCAA
ATCAGACAGAAGCAATGGAATTTGATATCTTCCAGAGATGGAAAGAGTGCAGGGGAAAGAGCCCTGCCCA
GGCGGAACTCTCCTATCTGAATAAAGCGAAGTGGCTGGAAATGTATGGGGTAGACATGCACGTTGTCAGG
GGAAGAGATGGCTGTGAATATTCTCTTGGACTGACCCCGACAGGCATATTAATCTTTGAAGGAGCTAACA
AAATAGGCTTATTCTTTTGGCCTAAAATTACCAAAATGGATTTTAAAAAGAGCAAATTGACACTCGTGGT
GGTCGAGGATGATGATCAGGGACGTGAGCAAGAGCACACGTTTGTGTTCCGGTTAGACAGTGCCAGGACC
TGCAAACACCTTTGGAAGTGTGCAGTTGAGCACCACGCATTCTTCCGACTGCGGACGCCAGGAAACAGCA
AATCCAATAGATCCGACTTTATCAGGCTGGGCTCTCGCTTCAGATTCAGTGGGCGGACAGAATATCAAGC
TACACATGGCTCCAGGTTACGAAGAACCAGCACCTTTGAGAGGAAGCCTAGTAAACGTTATCCATCCCGG
AGACATTCAACGTTCAAAGCAAGCAACCCAGTGATAGCAGCCCAGCTCTGCTCTAAAACAAATCCAGAAG
TCCATAATTACCAGCCTCAATATCATCCTAATATCCATCCCAGCCAGCCCCGGTGGCATCCTCACTCTCC
AAATGTCAGGCCATCCTTTCAGGATGACAGGTCGCATTGGAAAGCATCGGCCAGTGGAGATGACAGCCAT
TTTGATTATGTCCACGACCAGAACCAGAAGAACTTAGGAGGGATGCAAAGTATGATGTATCGAGATAAAC
TCATGACTGCACTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223085 representing NM_018424
Red=Cloning site Green=Tags(s)

MLRFLRRTFGRRSMQRYARGAAGRGAAGLGDERDGGPRGGPAAAASSSALPAAPGGSVFPAGGGPLLTGG
AAVHISAAGAAKATLYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVAHWL
DHAKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQ
AELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVR
GRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSART
CKHLWKCAVEHHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSR
RHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRWHPHSPNVRPSFQDDRSHWKASASGDDSH
FDYVHDQNQKNLGGMQSMMYRDKLMTAL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_018424
ORF Size 1554 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_018424.2, NM_018424.3, NP_060894
RefSeq Size 3783
RefSeq ORF 1557
Locus ID 54566
Cytogenetics 9q31.3
MW 58.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)