FUT8 (NM_178155) Human Tagged ORF Clone

CAT#: RC223075

Reviews ()
Write a review

FUT8 (Myc-DDK-tagged)-Human fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 1



  "NM_178155" in other vectors (6)

Reconstitution Protocol

USD 535.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "FUT8"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FUT8
Synonyms CDGF; CDGF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223075 representing NM_178155
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCCATGGACTGGTTCCTGGCGTTGGATTATGCTCATTCTTTTTGCCTGGGGGACCTTGCTGTTTT
ATATAGGTGGTCACTTGGTACGAGATAATGACCATCCTGATCACTCTAGCCGAGAACTGTCCAAGATTCT
GGCAAAGCTTGAACGCTTAAAACAACAGAATGAAGACTTGAGGCGAATGGCCGAATCTCTCCGGATACCA
GAAGGCCCTATTGATCAGGGGCCAGCTATAGGAAGAGTACGCGTTTTAGAAGAGCAGCTTGTTAAGGCCA
AAGAACAGATTGAAAATTACAAGAAACAGACCAGAAATGGTCTGGGGAAGGATCATGAAATCCTGAGGAG
GAGGATTGAAAATGGAGCTAAAGAGCTCTGGTTTTTCCTACAGAGTGAATTGAAGAAATTAAAGAACTTA
GAAGGAAATGAACTCCAAAGACATGCAGATGAATTTCTTTTGGATTTAGGACATCATGAAAGGTCTATAA
TGACGGATCTATACTACCTCAGTCAGACAGATGGAGCAGGTGATTGGCGGGAAAAAGAGGCCAAAGATCT
GACAGAACTGGTTCAGCGGAGAATAACATATCTTCAGAATCCCAAGGACTGCAGCAAAGCCAAAAAGCTG
GTGTGTAATATCAACAAAGGCTGTGGCTATGGCTGTCAGCTCCATCATGTGGTCTACTGCTTCATGATTG
CATATGGCACCCAGCGAACACTCATCTTGGAATCTCAGAATTGGCGCTATGCTACTGGTGGATGGGAGAC
TGTATTTAGGCCTGTAAGTGAGACATGCACAGACAGATCTGGCATCTCCACTGGACACTGGTCAGGTGAA
GTGAAGGACAAAAATGTTCAAGTGGTCGAGCTTCCCATTGTAGACAGTCTTCATCCCCGTCCTCCATATT
TACCCTTGGCTGTACCAGAAGACCTCGCAGATCGACTTGTACGAGTGCATGGTGACCCTGCAGTGTGGTG
GGTGTCTCAGTTTGTCAAATACTTGATCCGCCCACAGCCTTGGCTAGAAAAAGAAATAGAAGAAGCCACC
AAGAAGCTTGGCTTCAAACATCCAGTTATTGGAGTCCATGTCAGACGCACAGACAAAGTGGGAACAGAAG
CTGCCTTCCATCCCATTGAAGAGTACATGGTGCATGTTGAAGAACATTTTCAGCTTCTTGCACGCAGAAT
GCAAGTGGACAAAAAAAGAGTGTATTTGGCCACAGATGACCCTTCTTTATTAAAGGAGGCAAAAACAAAG
TACCCCAATTATGAATTTATTAGTGATAACTCTATTTCCTGGTCAGCTGGACTGCACAATCGATACACAG
AAAATTCACTTCGTGGAGTGATCCTGGATATACATTTTCTCTCTCAGGCAGACTTCCTAGTGTGTACTTT
TTCATCCCAGGTCTGTCGAGTTGCTTATGAAATTATGCAAACACTACATCCTGATGCCTCTGCAAACTTC
CATTCTTTAGATGACATCTACTATTTTGGGGGCCAGAATGCCCACAATCAAATTGCCATTTATGCTCACC
AACCCCGAACTGCAGATGAAATTCCCATGGAACCTGGAGATATCATTGGTGTGGCTGGAAATCATTGGGA
TGGCTATTCTAAAGGTGTCAACAGGAAATTGGGAAGGACGGGCCTATATCCCTCCTACAAAGTTCGAGAG
AAGATAGAAACGGTCAAGTACCCCACATATCCTGAGGCTGAGAAA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC223075 representing NM_178155
Red=Cloning site Green=Tags(s)

MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDLRRMAESLRIP
EGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKNL
EGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKL
VCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGE
VKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEAT
KKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK
YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANF
HSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVRE
KIETVKYPTYPEAEK

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_178155
ORF Size 1725 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_178155.3
RefSeq Size 3775 bp
RefSeq ORF 1728 bp
Locus ID 2530
UniProt ID Q9BYC5
Cytogenetics 14q23.3
Protein Families Transmembrane
Protein Pathways Keratan sulfate biosynthesis, Metabolic pathways, N-Glycan biosynthesis
MW 66.3 kDa
Gene Summary This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2011]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.