FUT8 (FUT8) (NM_178155) Human Tagged ORF Clone

CAT#: RC223075

FUT8 (Myc-DDK-tagged)-Human fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 1

Change vector?

USD 732


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FUT8 (FUT8) (NM_178155) Human Tagged ORF Clone
Symbol FUT8
Synonyms MGC26465
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC223075 representing NM_178155
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCCATGGACTGGTTCCTGGCGTTGGATTATGCTCATTCTTTTTGCCTGGGGGACCTTGCTGTTTT
ATATAGGTGGTCACTTGGTACGAGATAATGACCATCCTGATCACTCTAGCCGAGAACTGTCCAAGATTCT
GGCAAAGCTTGAACGCTTAAAACAACAGAATGAAGACTTGAGGCGAATGGCCGAATCTCTCCGGATACCA
GAAGGCCCTATTGATCAGGGGCCAGCTATAGGAAGAGTACGCGTTTTAGAAGAGCAGCTTGTTAAGGCCA
AAGAACAGATTGAAAATTACAAGAAACAGACCAGAAATGGTCTGGGGAAGGATCATGAAATCCTGAGGAG
GAGGATTGAAAATGGAGCTAAAGAGCTCTGGTTTTTCCTACAGAGTGAATTGAAGAAATTAAAGAACTTA
GAAGGAAATGAACTCCAAAGACATGCAGATGAATTTCTTTTGGATTTAGGACATCATGAAAGGTCTATAA
TGACGGATCTATACTACCTCAGTCAGACAGATGGAGCAGGTGATTGGCGGGAAAAAGAGGCCAAAGATCT
GACAGAACTGGTTCAGCGGAGAATAACATATCTTCAGAATCCCAAGGACTGCAGCAAAGCCAAAAAGCTG
GTGTGTAATATCAACAAAGGCTGTGGCTATGGCTGTCAGCTCCATCATGTGGTCTACTGCTTCATGATTG
CATATGGCACCCAGCGAACACTCATCTTGGAATCTCAGAATTGGCGCTATGCTACTGGTGGATGGGAGAC
TGTATTTAGGCCTGTAAGTGAGACATGCACAGACAGATCTGGCATCTCCACTGGACACTGGTCAGGTGAA
GTGAAGGACAAAAATGTTCAAGTGGTCGAGCTTCCCATTGTAGACAGTCTTCATCCCCGTCCTCCATATT
TACCCTTGGCTGTACCAGAAGACCTCGCAGATCGACTTGTACGAGTGCATGGTGACCCTGCAGTGTGGTG
GGTGTCTCAGTTTGTCAAATACTTGATCCGCCCACAGCCTTGGCTAGAAAAAGAAATAGAAGAAGCCACC
AAGAAGCTTGGCTTCAAACATCCAGTTATTGGAGTCCATGTCAGACGCACAGACAAAGTGGGAACAGAAG
CTGCCTTCCATCCCATTGAAGAGTACATGGTGCATGTTGAAGAACATTTTCAGCTTCTTGCACGCAGAAT
GCAAGTGGACAAAAAAAGAGTGTATTTGGCCACAGATGACCCTTCTTTATTAAAGGAGGCAAAAACAAAG
TACCCCAATTATGAATTTATTAGTGATAACTCTATTTCCTGGTCAGCTGGACTGCACAATCGATACACAG
AAAATTCACTTCGTGGAGTGATCCTGGATATACATTTTCTCTCTCAGGCAGACTTCCTAGTGTGTACTTT
TTCATCCCAGGTCTGTCGAGTTGCTTATGAAATTATGCAAACACTACATCCTGATGCCTCTGCAAACTTC
CATTCTTTAGATGACATCTACTATTTTGGGGGCCAGAATGCCCACAATCAAATTGCCATTTATGCTCACC
AACCCCGAACTGCAGATGAAATTCCCATGGAACCTGGAGATATCATTGGTGTGGCTGGAAATCATTGGGA
TGGCTATTCTAAAGGTGTCAACAGGAAATTGGGAAGGACGGGCCTATATCCCTCCTACAAAGTTCGAGAG
AAGATAGAAACGGTCAAGTACCCCACATATCCTGAGGCTGAGAAA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223075 representing NM_178155
Red=Cloning site Green=Tags(s)

MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDLRRMAESLRIP
EGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKNL
EGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKL
VCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGE
VKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEAT
KKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK
YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANF
HSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVRE
KIETVKYPTYPEAEK

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_178155
ORF Size 1725 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_178155.1, NM_178155.2, NP_835368
RefSeq Size 3775
RefSeq ORF 1728
Locus ID 2530
Cytogenetics 14q23.3
Protein Families Transmembrane
Protein Pathways N-Glycan biosynthesis, Keratan sulfate biosynthesis, Metabolic pathways
MW 66.3 kDa
Gene Summary This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations