S100A7L2 (NM_001045479) Human Tagged ORF Clone

CAT#: RC223024

Reviews ()
Write a review

S100A7L2 (Myc-DDK-tagged)-Human S100 calcium binding protein A7-like 2 (S100A7L2)



  "NM_001045479" in other vectors (4)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 98.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name S100A7L2 (NM_001045479) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol S100A7L2
Synonyms S100a7b
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC223024 representing NM_001045479
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTCCCAGCTCTGGCTTTTTGAAAGCAAAGATGAATATCCCTCTAGGTGAGAAAGTCATGTTGGACA
TAGTCGCGATGTTTCGCCAATACAGTGGAGATGATGGTAGGATGGACATGCCAGGTCTGGTGAACTTGAT
GAAGGAGAACTTCCCCAACTTCCTCAGTGGCTGTGAAAAAAGCGACATGGATTACTTGTCCAATGCCCTT
GAGAAAAAAGATGATAATAAGGATAAGAAGGTTAATTATTCTGAGTTTCTTTCCTTGCTGGGGGATATAA
CCATAGACCACCACAAGATAATGCATGGAGTGGCACCCTGTTCCGGGGGAAGCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223024 representing NM_001045479
Red=Cloning site Green=Tags(s)

MLPSSGFLKAKMNIPLGEKVMLDIVAMFRQYSGDDGRMDMPGLVNLMKENFPNFLSGCEKSDMDYLSNAL
EKKDDNKDKKVNYSEFLSLLGDITIDHHKIMHGVAPCSGGSQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001045479
ORF Size 336 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001045479.1, NP_001038944.2
RefSeq Size 480 bp
RefSeq ORF 339 bp
Locus ID 645922
Cytogenetics 1q21.3
MW 12.3 kDa
Gene Summary This locus is currently categorized as a non-transcribed pseudogene, but the locus type of this gene is unclear since it does contain an intact CDS. This locus lacks evidence indicating that it is transcribed, and very little of the upstream regions found in other family members are present at this locus. [provided by RefSeq, May 2018]

Other Versions

Other products for "S100A7L2"
Frequently bought together (2)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools