SPTLC1 (NM_006415) Human Tagged ORF Clone

CAT#: RC222985

Reviews ()
Write a review

SPTLC1 (Myc-DDK-tagged)-Human serine palmitoyltransferase, long chain base subunit 1 (SPTLC1), transcript variant 1



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "SPTLC1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SPTLC1
Synonyms HSAN1; HSN1; LBC1; LCB1; SPT1; SPTI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC222985 representing NM_006415
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACCGCCACGGAGCAGTGGGTTCTGGTGGAGATGGTACAGGCGCTTTACGAGGCTCCTGCTTACC
ATCTTATTTTGGAAGGGATTCTGATCCTCTGGATAATCAGACTTCTTTTCTCTAAGACTTACAAATTACA
AGAACGATCTGATCTTACAGTCAAGGAAAAAGAAGAACTGATTGAAGAGTGGCAACCAGAACCTCTTGTT
CCTCCTGTCCCAAAAGACCATCCTGCTCTCAACTACAACATCGTTTCAGGCCCTCCAAGCCACAAAACTG
TGGTGAATGGAAAAGAATGTATAAACTTCGCCTCATTTAATTTTCTTGGATTGTTGGATAACCCTAGGGT
TAAGGCAGCAGCTTTAGCATCTCTAAAGAAGTATGGCGTGGGGACTTGTGGACCCAGAGGATTTTATGGC
ACATTTGATGTTCATTTGGATTTGGAAGACCGCCTGGCAAAATTTATGAAGACAGAAGAAGCCATTATAT
ACTCATATGGATTTGCCACCATAGCCAGTGCTATTCCTGCTTACTCTAAAAGAGGGGACATTGTTTTTGT
AGATAGAGCTGCCTGCTTTGCTATTCAGAAAGGATTACAGGCATCCCGTAGTGACATTAAGTTATTTAAG
CATAATGACATGGCTGACCTCGAGCGACTACTAAAAGAACAAGAGATCGAAGATCAAAAGAATCCTCGCA
AGGCTCGTGTAACTCGGCGTTTCATTGTAGTAGAAGGATTGTATATGAATACTGGAACTATTTGTCCTCT
TCCAGAATTGGTTAAGTTAAAATACAAATACAAAGCAAGAATCTTCCTGGAGGAAAGCCTTTCATTTGGA
GTCCTAGGAGAGCATGGCCGAGGAGTCACTGAACACTATGGAATCAATATTGATGATATTGATCTTATCA
GTGCCAACATGGAGAATGCACTTGCTTCTATTGGAGGTTTCTGCTGTGGCAGGTCTTTTGTAATTGACCA
TCAGCGACTTTCCGGCCAGGGATACTGCTTTTCAGCTTCGTTACCTCCCCTGTTAGCTGCTGCAGCAATT
GAGGCCCTCAACATCATGGAAGAGAATCCAGGTATTTTTGCAGTGTTGAAGGAAAAGTGCGGACAAATTC
ATAAAGCTTTACAAGGCATTTCTGGATTAAAAGTGGTGGGGGAGTCCCTTTCTCCAGCCTTTCACCTACA
ACTGGAAGAGAGCACTGGGTCTCGCGAGCAAGATGTCAGACTGCTTCAGGAAATTGTAGATCAATGCATG
AACAGAAGTATTGCATTAACTCAGGCGCGCTACTTGGAGAAAGAAGAGAAGTGTCTCCCTCCTCCCAGCA
TTCGGGTTGTGGTCACGGTGGAACAAACAGAGGAAGAACTGGAGAGAGCTGCGTCCACCATCAAGGAGGT
AGCCCAGGCCGTCCTGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222985 representing NM_006415
Red=Cloning site Green=Tags(s)

MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLV
PPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYG
TFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFK
HNDMADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFG
VLGEHGRGVTEHYGINIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAI
EALNIMEENPGIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCM
NRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006415
ORF Size 1419 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006415.4
RefSeq Size 2780 bp
RefSeq ORF 1422 bp
Locus ID 10558
UniProt ID O15269
Cytogenetics 9q22.31
Domains aminotran_1_2
Protein Families Druggable Genome, Transmembrane
Protein Pathways Metabolic pathways, Sphingolipid metabolism
MW 52.6 kDa
Gene Summary This gene encodes a member of the class-II pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is the long chain base subunit 1 of serine palmitoyltransferase. Serine palmitoyltransferase converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate and is the key enzyme in sphingolipid biosynthesis. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified. Pseudogenes of this gene have been defined on chromosomes 1, 6, 10, and 13. [provided by RefSeq, Jul 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.