BOK (NM_032515) Human Tagged ORF Clone

CAT#: RC222963

Reviews ()
Write a review

BOK (Myc-DDK-tagged)-Human BCL2-related ovarian killer (BOK)



  "NM_032515" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BOK (NM_032515) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BOK
Synonyms BCL2L9; BOKL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC222963 representing NM_032515
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTGCTGCGGCGCTCCTCGGTCTTCGCCGCCGAGATCATGGACGCCTTTGACCGCTCGCCCACAG
ACAAGGAGCTGGTGGCCCAGGCCAAGGCGCTGGGCCGGGAGTACGTGCACGCGCGGCTGCTGCGCGCCGG
CCTCTCCTGGAGCGCGCCCGAGCGTGCCGCGCCGGTCCCGGGACGCCTGGCTGAGGTGTGCGCGGTGCTG
CTGCGCCTGGGCGATGAGCTGGAGATGATCCGGCCCAGCGTCTACCGCAACGTGGCGCGTCAGCTGCACA
TCTCCCTGCAGTCTGAGCCTGTGGTGACCGATGCGTTCCTGGCCGTGGCTGGCCACATCTTCTCTGCAGG
CATCACGTGGGGCAAGGTGGTGTCCCTGTATGCGGTGGCCGCGGGGCTGGCCGTGGACTGTGTGAGGCAG
GCCCAGCCTGCCATGGTCCACGCCCTCGTGGACTGCCTGGGGGAGTTCGTGCGCAAGACCCTGGCAACCT
GGCTGCGGAGACGCGGCGGATGGACTGATGTCCTCAAGTGTGTGGTCAGCACAGACCCTGGCCTCCGCTC
CCACTGGCTGGTGGCTGCACTCTGCAGCTTCGGCCGCTTCCTGAAGGCTGCCTTCTTCGTGCTGCTGCCA
GAGAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222963 representing NM_032515
Red=Cloning site Green=Tags(s)

MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVL
LRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQ
AQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLP
ER

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032515
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032515.1, NM_032515.2, NM_032515.3, NM_032515.4, NP_115904.1
RefSeq Size 2617 bp
RefSeq ORF 639 bp
Locus ID 666
Cytogenetics 2q37.3
Domains Bcl-2
Protein Families Druggable Genome
MW 23.1 kDa
Gene Summary The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family. [provided by RefSeq, Sep 2011]

Citations (1)

Other Versions

Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-FGF9 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools