EDEM3 (NM_025191) Human Tagged ORF Clone

CAT#: RC222885

EDEM3 (Myc-DDK-tagged)-Human ER degradation enhancer, mannosidase alpha-like 3 (EDEM3)

Clone Modification / Custom Cloning Service

USD 1,422.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EDEM3 (NM_025191) Human Tagged ORF Clone
Symbol EDEM3
Synonyms C1orf22
Vector pCMV6-Entry
Sequence Data
>RC222885 representing NM_025191
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGAAGCCGGCGGCCGGGGCTGTGGGTCCCCGGTTCCCCAGCGAGCGCGATGGAGACTAGTGGCGG
CGACGGCCGCGTTCTGCCTGGTGTCGGCCACCTCCGTGTGGACGGCGGGGGCCGAGCCCATGAGTAGGGA
GGAGAAACAGAAGCTTGGGAATCAAGTACTGGAAATGTTTGATCATGCTTATGGTAACTATATGGAACAT
GCTTACCCTGCTGATGAACTCATGCCTTTAACCTGTAGAGGTCGAGTTAGAGGCCAAGAGCCAAGTCGCG
GTGACGTTGATGATGCCTTGGGAAAATTTTCTCTGACACTGATTGATTCTTTGGACACTCTTGTGGTTTT
AAATAAAACTAAAGAATTTGAAGATGCAGTGAGAAAAGTTTTAAGAGATGTTAATTTAGATAACGATGTA
GTCGTATCAGTCTTTGAAACAAACATCAGAGTTCTTGGGGGTCTTTTGGGTGGGCACTCCCTGGCAATCA
TGCTGAAAGAAAAAGGTGAATATATGCAGTGGTACAATGATGAACTTCTCCAAATGGCAAAGCAGTTAGG
TTACAAACTTTTACCGGCTTTCAACACTACCAGTGGCCTTCCTTATCCAAGAATTAATTTAAAGTTTGGC
ATCAGAAAACCAGAAGCTCGGACAGGAACTGAGACAGATACCTGTACAGCTTGTGCAGGTACCTTGATCC
TTGAATTTGCTGCTTTAAGTCGATTCACAGGAGCAACAATATTTGAGGAATATGCCAGAAAAGCTCTTGA
TTTTCTCTGGGAAAAAAGACAGCGAAGTAGTAATTTAGTGGGCGTGACTATAAATATTCATACTGGAGAT
TGGGTACGAAAAGATAGTGGAGTTGGAGCAGGGATTGATTCATATTATGAATATCTGTTGAAAGCCTATG
TCTTGCTTGGAGATGACAGTTTTCTGGAAAGATTTAACACACACTATGATGCCATAATGAGGTATATTAG
CCAGCCACCTCTTCTACTTGATGTGCATATCCACAAACCAATGCTGAATGCTCGGACTTGGATGGATGCT
TTGCTTGCCTTCTTCCCAGGCTTGCAGGTGTTAAAGGGGGATATTAGACCTGCTATTGAAACTCATGAAA
TGTTATATCAGGTGATTAAAAAACACAATTTTCTACCAGAGGCATTTACCACAGATTTCAGAGTACACTG
GGCTCAACATCCTTTAAGGCCAGAATTTGCAGAAAGTACCTACTTCTTATATAAAGCTACAGGAGATCCT
TACTACCTTGAAGTAGGGAAGACACTTATTGAAAATTTAAATAAATATGCTAGAGTGCCTTGCGGATTTG
CTGCCATGAAGGATGTTCGTACTGGAAGTCATGAGGACAGAATGGATTCTTTCTTCTTGGCTGAAATGTT
TAAATATCTTTACCTGTTATTTGCTGATAAAGAAGACATTATTTTTGACATAGAAGATTACATCTTTACA
ACAGAAGCTCATCTGTTACCTCTTTGGCTCTCTACTACAAATCAAAGCATCTCTAAAAAGAACACAACCT
CGGAATATACAGAACTGGATGACAGTAACTTCGATTGGACTTGTCCAAATACTCAGATCCTCTTTCCTAA
TGACCCATTGTATGCTCAAAGTATTCGTGAGCCCTTGAAAAATGTGGTGGATAAGAGCTGTCCTAGAGGC
ATCATCAGAGTAGAGGAGAGTTTCAGGAGTGGAGCTAAACCCCCTCTGAGAGCCAGAGATTTCATGGCCA
CTAACCCTGAGCATTTAGAAATCCTGAAGAAGATGGGGGTGAGTTTGATTCACCTCAAAGATGGGAGAGT
CCAGTTGGTCCAACATGCAATCCAAGCTGCTAGTTCAATCGACGCTGAAGATGGGTTGAGGTTCATGCAG
GAGATGATTGAATTGTCAAGTCAGCAACAAAAAGAACAGCAGCTGCCTCCACGAGCTGTACAAATTGTTT
CCCACCCATTTTTTGGCAGGGTAGTATTGACTGCTGGACCAGCTCAGTTTGGGCTGGATCTGTCTAAACA
TAAAGAGACAAGAGGATTTGTTGCAAGCAGTAAACCATCCAATGGTTGTTCAGAGCTTACTAACCCAGAG
GCAGTGATGGGAAAAATCGCACTGATACAAAGAGGACAGTGCATGTTTGCAGAAAAGGCACGCAACATCC
AGAATGCTGGAGCCATTGGTGGCATTGTTATTGATGACAATGAGGGGAGCAGCAGTGATACTGCCCCTCT
GTTCCAGATGGCAGGTGATGGAAAGGATACAGATGACATCAAGATCCCCATGCTGTTCTTATTCAGCAAA
GAAGGAAGTATCATACTGGATGCCATCCGGGAATATGAGGAGGTAGAAGTGCTCCTCTCTGATAAAGCAA
AAGATCGAGATCCTGAAATGGAAAATGAAGAACAACCATCCTCTGAAAATGATTCTCAGAATCAGAGTGG
TGAACAGATTTCATCAAGTTCTCAGGAGGTTGATTTGGTTGATCAAGAGTCTTCTGAGGAAAATTCTCTA
AATTCTCACCCAGAATCATTATCTCTAGCAGATATGGACAATGCTGCAAGCATTTCCCCTTCTGAACAGA
CTTCTAATCCCACAGAAAACCATGAGACTACAAATCTTAATGGTGAATGTACAGATTTAGATAACCAGCT
TCAAGAACAATCAGAAACTGAGGAAGATTCCAATCCTAATGTTAGCTGGGGTAAAAAGGTCCAGCCTATA
GACTCCATATTAGCAGACTGGAATGAAGATATAGAAGCATTTGAAATGATGGAGAAGGATGAGCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222885 representing NM_025191
Red=Cloning site Green=Tags(s)

MSEAGGRGCGSPVPQRARWRLVAATAAFCLVSATSVWTAGAEPMSREEKQKLGNQVLEMFDHAYGNYMEH
AYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKTKEFEDAVRKVLRDVNLDNDV
VVSVFETNIRVLGGLLGGHSLAIMLKEKGEYMQWYNDELLQMAKQLGYKLLPAFNTTSGLPYPRINLKFG
IRKPEARTGTETDTCTACAGTLILEFAALSRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGD
WVRKDSGVGAGIDSYYEYLLKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDA
LLAFFPGLQVLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGDP
YYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKEDIIFDIEDYIFT
TEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPLKNVVDKSCPRG
IIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSLIHLKDGRVQLVQHAIQAASSIDAEDGLRFMQ
EMIELSSQQQKEQQLPPRAVQIVSHPFFGRVVLTAGPAQFGLDLSKHKETRGFVASSKPSNGCSELTNPE
AVMGKIALIQRGQCMFAEKARNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSK
EGSIILDAIREYEEVEVLLSDKAKDRDPEMENEEQPSSENDSQNQSGEQISSSSQEVDLVDQESSEENSL
NSHPESLSLADMDNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPNVSWGKKVQPI
DSILADWNEDIEAFEMMEKDEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_025191
ORF Size 2796 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_025191.3, NP_079467
RefSeq Size 6670
RefSeq ORF 2799
Locus ID 80267
Cytogenetics 1q25.3
Domains Glyco_hydro_47, PA
MW 105.1 kDa
Gene Summary Quality control in the endoplasmic reticulum (ER) ensures that only properly folded proteins are retained in the cell through recognition and degradation of misfolded or unassembled proteins. EDEM3 belongs to a group of proteins that accelerate degradation of misfolded glycoproteins in the ER (Hirao et al., 2006 [PubMed 16431915]).[supplied by OMIM, Mar 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)