CTNND1 (NM_001085458) Human Tagged ORF Clone

CAT#: RC222771

CTNND1 (Myc-DDK-tagged)-Human catenin (cadherin-associated protein), delta 1 (CTNND1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 1,473.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CTNND1 (NM_001085458) Human Tagged ORF Clone
Symbol CTNND1
Synonyms CAS; CTNND; p120; p120(CAS); p120(CTN); P120CAS; P120CTN
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC222771 representing NM_001085458
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGACTCAGAGGTGGAGTCGACCGCCAGCATCTTGGCCTCTGTGAAGGAACAAGAGGCCCAGTTTG
AGAAGCTGACCCGGGCGCTGGAGGAGGAACGGCGCCACGTCTCGGCGCAGCTGGAACGCGTCCGGGTCTC
ACCACAAGATGCCAACCCACTCATGGCCAACGGCACACTCACCCGCCGGCATCAGAACGGCCGGTTTGTG
GGCGATGCTGACCTTGAAAGACAGAAATTTTCAGATTTGAAACTCAACGGACCCCAGGATCACAGTCACC
TTCTATATAGCACCATCCCCAGGATGCAGGAGCCGGGGCAGATTGTGGAGACCTACACGGAGGAGGATCC
TGAGGGAGCCATGTCTGTAGTCTCTGTGGAGACCTCAGATGATGGGACCACTCGGCGCACAGAGACCACG
GTCAAGAAAGTAGTGAAGACTGTGACAACACGGACAGTACAGCCAGTCGCTATGGGACCAGACGGGTTGC
CTGTGGATGCTTCATCAGTTTCTAACAACTATATCCAGACTTTGGGTCGTGATTTCCGCAAGAATGGCAA
TGGGGGACCTGGTCCCTATGTGGGGCAAGCTGGCACTGCTACCCTTCCTAGGAACTTCCACTACCCTCCT
GATGGTTATAGTCGCCACTATGAAGATGGTTATCCAGGTGGCAGTGATAACTATGGCAGTCTGTCCCGGG
TGACCCGCATTGAGGAGCGGTATAGGCCCAGCATGGAAGGCTACCGGGCACCTAGTAGACAGGATGTGTA
TGGGCCCCAACCCCAGGTTCGGGTAGGTGGGAGCAGCGTGGATCTGCATCGCTTTCATCCAGAGCCTTAT
GGGCTAGAGGATGACCAGCGTAGTATGGGCTATGATGACCTGGATTATGGTATGATGTCTGATTATGGCA
CTGCCCGTCGGACTGGGACACCCTCTGACCCTCGTCGGCGCCTCAGGAGCTATGAAGACATGATTGGTGA
GGAGGTGCCATCGGATCAATACTACTGGGCTCCTTTGGCCCAGCATGAGCGAGGAAGTTTAGCAAGCTTG
GATAGCCTGCGCAAAGGAGGGCCTCCACCTCCTAATTGGAGACAGCCAGAGCTGCCAGAGGTGATCGCCA
TGCTTGGATTCCGCTTGGATGCTGTCAAGTCCAATGCAGCTGCATACCTGCAACACTTATGCTACCGCAA
TGACAAGGTGAAGACTGACGTGCGGAAGCTCAAGGGCATCCCAGTACTGGTGGGATTGTTAGACCATCCC
AAAAAGGAAGTGCACCTTGGAGCCTGTGGAGCTCTCAAGAATATCTCTTTTGGACGTGACCAGGATAACA
AGATTGCCATAAAAAACTGTGATGGTGTGCCTGCCCTTGTGCGATTGCTTCGAAAGGCTCGTGATATGGA
CCTTACTGAAGTTATTACCGGAACCCTGTGGAATCTTTCATCCCATGACTCAATCAAAATGGAGATTGTG
GACCATGCACTGCATGCCTTGACAGATGAAGTGATCATTCCTCATTCTGGTTGGGAGCGGGAACCTAATG
AAGACTGTAAGCCACGCCATATTGAGTGGGAATCGGTGCTCACCAACACAGCTGGCTGCCTTAGGAATGT
AAGCTCAGAGAGGAGTGAAGCTCGCCGGAAACTTCGGGAATGTGATGGTTTAGTTGATGCCCTCATTTTC
ATTGTTCAGGCTGAGATTGGGCAGAAGGATTCAGACAGCAAGCTTGTAGAGAACTGTGTTTGCCTTCTTC
GGAACTTATCATATCAAGTTCACCGGGAGATCCCACAGGCAGAGCGTTACCAAGAGGCAGCTCCCAATGT
TGCCAACAATACTGGGCCACATGCTGCCAGTTGCTTTGGGGCCAAGAAGGGCAAAGATGAGTGGTTCTCC
AGAGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTC
GAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGAC
TCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGA
TACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATG
AACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAAT
TGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCA
AAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAA
AGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAA
AAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATT
CATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGA
AATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGA
GGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACAC
CCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGG
GGGCCAAGTGTCTTACCCCTCCATGCAGAAGATT


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222771 representing NM_001085458
Red=Cloning site Green=Tags(s)

MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFV
GDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETT
VKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPP
DGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPY
GLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASL
DSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHP
KKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIV
DHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIF
IVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFS
RGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGR
YIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNF
SEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLE
KEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNER
GDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001085458
ORF Size 2904 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001085458.1, NP_001078927
RefSeq Size 6363
RefSeq ORF 2907
Locus ID 1500
Cytogenetics 11q12.1
Protein Families Druggable Genome
Protein Pathways Adherens junction, Leukocyte transendothelial migration
MW 108.2 kDa
Gene Summary This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene. [provided by RefSeq, Dec 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)