ADAM23 (NM_003812) Human Tagged ORF Clone

CAT#: RC222765

ADAM23 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 23 (ADAM23)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name ADAM23 (NM_003812) Human Tagged ORF Clone
Symbol ADAM23
Synonyms MDC-3; MDC3
Vector pCMV6-Entry
Sequence Data
>RC222765 representing NM_003812
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCCGCCCGGCAGCAGCTCGCGGCAGCCGCCCCTGGCGGGCTGCAGCCTTGCCGGCGCTTCCTGCG
GCCCCCAACGCGGCCCCGCCGGCTCGGTGCCTGCCAGCGCCCCGGCCCGCACGCCGCCCTGCCGCCTGCT
TCTCGTCCTTCTCCTGCTGCCTCCGCTCGCCGCCTCGTCCCGGCCCCGCGCCTGGGGGGCTGCTGCGCCC
AGCGCTCCGCATTGGAATGAAACTGCAGAAAAAAATTTGGGAGTCCTGGCAGATGAAGACAATACATTGC
AACAGAATAGCAGCAGTAATATCAGTTACAGCAATGCAATGCAGAAAGAAATCACACTGCCTTCAAGACT
CATATATTACATCAACCAAGACTCGGAAAGCCCTTATCACGTTCTTGACACAAAGGCAAGACACCAGCAA
AAACATAATAAGGCTGTCCATCTGGCCCAGGCAAGCTTCCAGATTGAAGCCTTCGGCTCCAAATTCATTC
TTGACCTCATACTGAACAATGGTTTGTTGTCTTCTGATTATGTGGAGATTCACTACGAAAATGGGAAACC
ACAGTACTCTAAGGGTGGAGAGCACTGTTACTACCATGGAAGCATCAGAGGCGTCAAAGACTCCAAGGTG
GCTCTGTCAACCTGCAATGGACTTCATGGCATGTTTGAAGATGATACCTTCGTGTATATGATAGAGCCAC
TAGAGCTGGTTCATGATGAGAAAAGCACAGGTCGACCACATATAATCCAGAAAACCTTGGCAGGACAGTA
TTCTAAGCAAATGAAGAATCTCACTATGGAAAGAGGTGACCAGTGGCCCTTTCTCTCTGAATTACAGTGG
TTGAAAAGAAGGAAGAGAGCAGTGAATCCATCACGTGGTATATTTGAAGAAATGAAATATTTGGAACTTA
TGATTGTTAATGATCACAAAACGTATAAGAAGCATCGCTCTTCTCATGCACATACCAACAACTTTGCAAA
GTCCGTGGTCAACCTTGTGGATTCTATTTACAAGGAGCAGCTCAACACCAGGGTTGTCCTGGTGGCTGTA
GAGACCTGGACTGAGAAGGATCAGATTGACATCACCACCAACCCTGTGCAGATGCTCCATGAGTTCTCAA
AATACCGGCAGCGCATTAAGCAGCATGCTGATGCTGTGCACCTCATCTCGCGGGTGACATTTCACTATAA
GAGAAGCAGTCTGAGTTACTTTGGAGGTGTCTGTTCTCGCACAAGAGGAGTTGGTGTGAATGAGTATGGT
CTTCCAATGGCAGTGGCACAAGTATTATCGCAGAGCCTGGCTCAAAACCTTGGAATCCAATGGGAACCTT
CTAGCAGAAAGCCAAAATGTGACTGCACAGAATCCTGGGGTGGCTGCATCATGGAGGAAACAGGGGTGTC
CCATTCTCGAAAATTTTCAAAGTGCAGCATTTTGGAGTATAGAGACTTTTTACAGAGAGGAGGTGGAGCC
TGCCTTTTCAACAGGCCAACAAAGCTATTTGAGCCCACGGAATGTGGAAATGGATACGTGGAAGCTGGGG
AGGAGTGTGATTGTGGTTTTCATGTGGAATGCTATGGATTATGCTGTAAGAAATGTTCCCTCTCCAACGG
GGCTCACTGCAGCGACGGGCCCTGCTGTAACAATACCTCATGTCTTTTTCAGCCACGAGGGTATGAATGC
CGGGATGCTGTGAACGAGTGTGATATTACTGAATATTGTACTGGAGACTCTGGTCAGTGCCCACCAAATC
TTCATAAGCAAGACGGATATGCATGCAATCAAAATCAGGGCCGCTGCTACAATGGCGAGTGCAAGACCAG
AGACAACCAGTGTCAGTACATCTGGGGAACAAAGGCTGCAGGGTCTGACAAGTTCTGCTATGAAAAGCTG
AATACAGAAGGCACTGAGAAGGGAAACTGCGGGAAGGATGGAGACCGGTGGATTCAGTGCAGCAAACATG
ATGTGTTCTGTGGATTCTTACTCTGTACCAATCTTACTCGAGCTCCACGTATTGGTCAACTTCAGGGTGA
GATCATTCCAACTTCCTTCTACCATCAAGGCCGGGTGATTGACTGCAGTGGTGCCCATGTAGTTTTAGAT
GATGATACGGATGTGGGCTATGTAGAAGATGGAACGCCATGTGGCCCGTCTATGATGTGTTTAGATCGGA
AGTGCCTACAAATTCAAGCCCTAAATATGAGCAGCTGTCCACTCGATTCCAAGGGTAAAGTCTGTTCGGG
CCATGGGGTGTGTAGTAATGAAGCCACCTGCATTTGTGATTTCACCTGGGCAGGGACAGATTGCAGTATC
CGGGATCCAGTTAGGAACCTTCACCCCCCCAAGGATGAAGGACCCAAGGGTCCTAGTGCCACCAATCTCA
TAATAGGCTCCATCGCTGGTGCCATCCTGGTAGCAGCTATTGTCCTTGGGGGCACAGGCTGGGGATTTAA
AAATGTCAAGAAGAGAAGGTTCGATCCTACTCAGCAAGGCCCCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222765 representing NM_003812
Red=Cloning site Green=Tags(s)

MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASSRPRAWGAAAP
SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQ
KHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKV
ALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQW
LKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAV
ETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG
LPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGA
CLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYEC
RDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKL
NTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLD
DDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSI
RDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003812
ORF Size 2496 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003812.1, NM_003812.2, NM_003812.3, NP_003803
RefSeq Size 3059
RefSeq ORF 2499
Locus ID 8745
Cytogenetics 2q33.3
Domains Reprolysin, DISIN, Pep_M12B_propep, ACR
Protein Families Secreted Protein, Transmembrane, Protease, Druggable Genome
MW 91.7 kDa
Gene Summary May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)