ADAM23 (NM_003812) Human Tagged ORF Clone

CAT#: RC222765

Reviews ()
Write a review

ADAM23 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 23 (ADAM23)



  "NM_003812" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ADAM23 (NM_003812) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ADAM23
Synonyms MDC-3; MDC3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC222765 representing NM_003812
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCCGCCCGGCAGCAGCTCGCGGCAGCCGCCCCTGGCGGGCTGCAGCCTTGCCGGCGCTTCCTGCG
GCCCCCAACGCGGCCCCGCCGGCTCGGTGCCTGCCAGCGCCCCGGCCCGCACGCCGCCCTGCCGCCTGCT
TCTCGTCCTTCTCCTGCTGCCTCCGCTCGCCGCCTCGTCCCGGCCCCGCGCCTGGGGGGCTGCTGCGCCC
AGCGCTCCGCATTGGAATGAAACTGCAGAAAAAAATTTGGGAGTCCTGGCAGATGAAGACAATACATTGC
AACAGAATAGCAGCAGTAATATCAGTTACAGCAATGCAATGCAGAAAGAAATCACACTGCCTTCAAGACT
CATATATTACATCAACCAAGACTCGGAAAGCCCTTATCACGTTCTTGACACAAAGGCAAGACACCAGCAA
AAACATAATAAGGCTGTCCATCTGGCCCAGGCAAGCTTCCAGATTGAAGCCTTCGGCTCCAAATTCATTC
TTGACCTCATACTGAACAATGGTTTGTTGTCTTCTGATTATGTGGAGATTCACTACGAAAATGGGAAACC
ACAGTACTCTAAGGGTGGAGAGCACTGTTACTACCATGGAAGCATCAGAGGCGTCAAAGACTCCAAGGTG
GCTCTGTCAACCTGCAATGGACTTCATGGCATGTTTGAAGATGATACCTTCGTGTATATGATAGAGCCAC
TAGAGCTGGTTCATGATGAGAAAAGCACAGGTCGACCACATATAATCCAGAAAACCTTGGCAGGACAGTA
TTCTAAGCAAATGAAGAATCTCACTATGGAAAGAGGTGACCAGTGGCCCTTTCTCTCTGAATTACAGTGG
TTGAAAAGAAGGAAGAGAGCAGTGAATCCATCACGTGGTATATTTGAAGAAATGAAATATTTGGAACTTA
TGATTGTTAATGATCACAAAACGTATAAGAAGCATCGCTCTTCTCATGCACATACCAACAACTTTGCAAA
GTCCGTGGTCAACCTTGTGGATTCTATTTACAAGGAGCAGCTCAACACCAGGGTTGTCCTGGTGGCTGTA
GAGACCTGGACTGAGAAGGATCAGATTGACATCACCACCAACCCTGTGCAGATGCTCCATGAGTTCTCAA
AATACCGGCAGCGCATTAAGCAGCATGCTGATGCTGTGCACCTCATCTCGCGGGTGACATTTCACTATAA
GAGAAGCAGTCTGAGTTACTTTGGAGGTGTCTGTTCTCGCACAAGAGGAGTTGGTGTGAATGAGTATGGT
CTTCCAATGGCAGTGGCACAAGTATTATCGCAGAGCCTGGCTCAAAACCTTGGAATCCAATGGGAACCTT
CTAGCAGAAAGCCAAAATGTGACTGCACAGAATCCTGGGGTGGCTGCATCATGGAGGAAACAGGGGTGTC
CCATTCTCGAAAATTTTCAAAGTGCAGCATTTTGGAGTATAGAGACTTTTTACAGAGAGGAGGTGGAGCC
TGCCTTTTCAACAGGCCAACAAAGCTATTTGAGCCCACGGAATGTGGAAATGGATACGTGGAAGCTGGGG
AGGAGTGTGATTGTGGTTTTCATGTGGAATGCTATGGATTATGCTGTAAGAAATGTTCCCTCTCCAACGG
GGCTCACTGCAGCGACGGGCCCTGCTGTAACAATACCTCATGTCTTTTTCAGCCACGAGGGTATGAATGC
CGGGATGCTGTGAACGAGTGTGATATTACTGAATATTGTACTGGAGACTCTGGTCAGTGCCCACCAAATC
TTCATAAGCAAGACGGATATGCATGCAATCAAAATCAGGGCCGCTGCTACAATGGCGAGTGCAAGACCAG
AGACAACCAGTGTCAGTACATCTGGGGAACAAAGGCTGCAGGGTCTGACAAGTTCTGCTATGAAAAGCTG
AATACAGAAGGCACTGAGAAGGGAAACTGCGGGAAGGATGGAGACCGGTGGATTCAGTGCAGCAAACATG
ATGTGTTCTGTGGATTCTTACTCTGTACCAATCTTACTCGAGCTCCACGTATTGGTCAACTTCAGGGTGA
GATCATTCCAACTTCCTTCTACCATCAAGGCCGGGTGATTGACTGCAGTGGTGCCCATGTAGTTTTAGAT
GATGATACGGATGTGGGCTATGTAGAAGATGGAACGCCATGTGGCCCGTCTATGATGTGTTTAGATCGGA
AGTGCCTACAAATTCAAGCCCTAAATATGAGCAGCTGTCCACTCGATTCCAAGGGTAAAGTCTGTTCGGG
CCATGGGGTGTGTAGTAATGAAGCCACCTGCATTTGTGATTTCACCTGGGCAGGGACAGATTGCAGTATC
CGGGATCCAGTTAGGAACCTTCACCCCCCCAAGGATGAAGGACCCAAGGGTCCTAGTGCCACCAATCTCA
TAATAGGCTCCATCGCTGGTGCCATCCTGGTAGCAGCTATTGTCCTTGGGGGCACAGGCTGGGGATTTAA
AAATGTCAAGAAGAGAAGGTTCGATCCTACTCAGCAAGGCCCCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222765 representing NM_003812
Red=Cloning site Green=Tags(s)

MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASSRPRAWGAAAP
SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQ
KHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKV
ALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQW
LKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAV
ETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG
LPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGA
CLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYEC
RDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKL
NTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLD
DDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSI
RDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003812
ORF Size 2496 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003812.1, NM_003812.2, NM_003812.3, NP_003803.1
RefSeq Size 3059 bp
RefSeq ORF 2499 bp
Locus ID 8745
Cytogenetics 2q33.3
Domains Reprolysin, DISIN, Pep_M12B_propep, ACR
Protein Families Druggable Genome, Protease, Secreted Protein, Transmembrane
MW 91.7 kDa
Gene Summary This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. It is reported that inactivation of this gene is associated with tumorigenesis in human cancers. [provided by RefSeq, May 2013]

Citations (2)

Other Versions

Other products for "ADAM23"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-ADAM23 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools