Adenylate cyclase 1(ADCY1) (NM_021116) Human Tagged ORF Clone

CAT#: RC222738

ADCY1 (Myc-DDK-tagged)-Human adenylate cyclase 1 (brain) (ADCY1)

Clone Modification / Custom Cloning Service

USD 1,721.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Adenylate cyclase 1(ADCY1) (NM_021116) Human Tagged ORF Clone
Symbol ADCY1
Synonyms AC1; DFNB44
Vector pCMV6-Entry
Sequence Data
>RC222738 representing NM_021116
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGGGCGCCGCGCGGCGGAGGCGGCGGCGGAGGCGGCGCGGGCGAGCCCGGGGGCGCCGAGCGGG
CGGCCGGGACAAGCCGCCGGCGCGGGCTCCGGGCGTGCGACGAGGAGTTCGCTTGCCCAGAGCTGGAGGC
GCTGTTCCGCGGCTACACGCTGCGGCTGGAGCAGGCGGCCACGCTGAAGGCGCTGGCCGTTCTCAGCCTG
CTGGCGGGCGCGCTGGCGCTGGCCGAGCTGCTGGGCGCGCCGGGGCCCGCGCCCGGCCTGGCCAAGGGCT
CACACCCGGTGCACTGCGTCCTCTTCCTGGCGCTGCTCGTGGTAACCAACGTCCGGTCCCTGCAGGTGCC
CCAGCTGCAGCAGGTCGGCCAGCTGGCGCTGCTCTTCAGCCTCACCTTCGCGCTGCTCTGCTGTCCTTTC
GCGCTGGGCGGCCCCGCCCGGGGTTCCGCCGGGGCCGCTGGGGGGCCAGCGACCGCCGAACAAGGGGTTT
GGCAGCTCCTTTTGGTCACCTTCGTGTCCTATGCCTTGCTGCCCGTGCGCAGCCTGCTGGCCATAGGCTT
TGGGCTCGTGGTGGCTGCGTCGCACTTGCTGGTCACAGCCACCTTGGTCCCCGCCAAGCGCCCACGTCTC
TGGAGGACGCTCGGTGCCAATGCCTTGCTCTTCGTCGGTGTGAACATGTATGGGGTCTTTGTGCGGATTC
TGACTGAGCGTTCACAGAGGAAGGCGTTCCTGCAGGCCCGGAGCTGCATTGAGGACCGACTGAGGCTGGA
GGATGAGAACGAGAAGCAGGAGCGGCTCCTCATGAGCCTCCTGCCCCGGAACGTTGCCATGGAGATGAAG
GAGGACTTCCTGAAGCCCCCTGAGAGGATTTTCCACAAGATTTACATCCAGAGGCACGACAATGTGAGCA
TCCTGTTTGCTGACATCGTGGGTTTCACGGGCTTGGCATCCCAGTGCACAGCCCAGGAGCTGGTGAAACT
CCTCAATGAGCTCTTCGGCAAGTTCGATGAATTAGCCACGGAGAACCACTGTCGCCGCATCAAGATTCTC
GGGGACTGCTACTACTGCGTGTCGGGCCTCACCCAGCCCAAGACTGACCATGCCCACTGCTGTGTGGAGA
TGGGACTCGACATGATTGATACCATCACATCTGTGGCTGAAGCCACCGAGGTGGATCTGAACATGCGTGT
GGGTCTGCACACGGGCAGGGTCCTCTGTGGTGTCCTGGGCTTGCGCAAGTGGCAGTACGACGTGTGGTCC
AATGATGTGACCTTGGCCAATGTCATGGAAGCCGCTGGCCTGCCAGGGAAGGTTCATATCACAAAGACGA
CCCTAGCGTGCTTGAATGGGGACTACGAGGTAGAACCGGGTTACGGACATGAGAGGAACAGTTTCTTGAA
AACTCATAACATCGAAACCTTTTTTATTGTGCCATCCCATCGCCGAAAGATATTTCCAGGCCTGATTCTC
TCAGATATAAAACCGGCCAAAAGGATGAAGTTCAAGACTGTCTGCTACCTGCTGGTGCAGCTCATGCACT
GCCGGAAAATGTTCAAGGCCGAGATCCCCTTCTCCAATGTCATGACCTGCGAGGACGATGACAAGCGGAG
GGCATTAAGAACAGCCTCGGAAAAACTCAGAAACCGCTCATCTTTTTCTACCAACGTTGTCTACACCACC
CCGGGCACTCGCGTCAACAGGTACATCAGCCGCCTCTTAGAAGCCCGCCAGACAGAGCTGGAGATGGCAG
ACCTGAACTTCTTTACCCTGAAGTACAAACATGTCGAACGGGAGCAAAAGTACCACCAGCTTCAGGACGA
GTATTTCACCAGCGCCGTTGTCCTCACCCTCATCCTGGCTGCCTTATTTGGCCTTGTCTACCTTCTAATA
TTCCCACAGAGTGTGGTCGTCCTGCTCCTGCTAGTATTCTGCATCTGCTTCCTGGTGGCCTGTGTCCTGT
ACCTGCACATCACCCGGGTCCAGTGTTTTCCAGGGTGCCTGACGATTCAGATTCGCACTGTCCTGTGTAT
TTTCATAGTGGTCTTAATCTACTCAGTAGCCCAAGGTTGTGTGGTGGGCTGCCTGCCTTGGGCCTGGAGC
TCCAAGCCCAACAGTTCCCTGGTGGTCCTTTCGTCTGGGGGCCAGCGCACAGCCCTGCCCACCCTGCCCT
GCGAGTCTACACACCATGCCCTGCTCTGCTGCCTGGTGGGCACCCTCCCGCTAGCCATATTTTTCCGGGT
GTCCTCCTTGCCAAAAATGATCCTGCTCTCCGGGCTCACCACGTCCTACATCCTCGTTCTGGAGCTCAGC
GGATACACCAGGACTGGGGGTGGTGCCGTCTCCGGGCGCAGCTACGAGCCGATTGTGGCCATCCTGCTCT
TCTCCTGTGCGCTGGCCCTGCATGCCAGGCAGGTGGACATCAGGCTGAGGCTGGACTACCTCTGGGCCGC
ACAGGCAGAGGAGGAGCGAGAGGACATGGAGAAGGTGAAGCTGGACAACAGGCGCATCCTCTTCAACCTC
CTGCCGGCCCACGTCGCCCAGCACTTCCTCATGTCCAACCCTCGGAACATGGACCTCTACTACCAGTCCT
ACTCCCAGGTGGGCGTCATGTTTGCCTCCATCCCCAACTTCAATGACTTCTACATCGAGCTGGACGGCAA
CAACATGGGGGTGGAGTGTCTGCGGCTTCTCAACGAGATCATCGCCGACTTTGACGAGCTCATGGAAAAA
GACTTTTACAAGGACATAGAGAAGATCAAGACCATCGGGAGCACCTACATGGCCGCTGTGGGGCTAGCGC
CCACCTCGGGGACCAAGGCTAAGAAGTCCATCTCCTCCCACCTGAGCACGCTGGCGGACTTTGCCATTGA
GATGTTTGACGTTCTGGATGAAATCAACTACCAGTCTTACAACGACTTTGTCCTCCGAGTTGGCATCAAT
GTTGGCCCTGTGGTGGCTGGAGTGATTGGCGCTCGCAGGCCCCAGTACGACATCTGGGGAAACACAGTCA
ACGTGGCCAGTCGGATGGATAGCACAGGGGTCCAGGGCAGAATCCAGGTGACTGAGGAAGTCCACCGGCT
GCTGAGAAGGTGCCCCTACCACTTTGTGTGCCGAGGCAAAGTCAGTGTCAAGGGCAAAGGCGAGATGTTG
ACATACTTTCTAGAAGGCAGGACTGATGGAAACGGCTCCCAAATCAGGTCCCTGGGCTTGGATCGGAAAA
TGTGTCCATTTGGGAGAGCTGGCCTTCAGGGCAGACGTCCCCCCGTGTGCCCCATGCCTGGCGTCTCAGT
CAGGGCTGGGCTCCCTCCACACTCCCCAGGCCAGTACCTGCCCTCTGCAGCAGCTGGGAAGGAGGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222738 representing NM_021116
Red=Cloning site Green=Tags(s)

MAGAPRGGGGGGGGAGEPGGAERAAGTSRRRGLRACDEEFACPELEALFRGYTLRLEQAATLKALAVLSL
LAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQQVGQLALLFSLTFALLCCPF
ALGGPARGSAGAAGGPATAEQGVWQLLLVTFVSYALLPVRSLLAIGFGLVVAASHLLVTATLVPAKRPRL
WRTLGANALLFVGVNMYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMK
EDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKIL
GDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWS
NDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSHRRKIFPGLIL
SDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFSTNVVYTT
PGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQKYHQLQDEYFTSAVVLTLILAALFGLVYLLI
FPQSVVVLLLLVFCICFLVACVLYLHITRVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWS
SKPNSSLVVLSSGGQRTALPTLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELS
GYTRTGGGAVSGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNL
LPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEK
DFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGIN
VGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLRRCPYHFVCRGKVSVKGKGEML
TYFLEGRTDGNGSQIRSLGLDRKMCPFGRAGLQGRRPPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021116
ORF Size 3357 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021116.1, NM_021116.2, NP_066939
RefSeq Size 12499
RefSeq ORF 3360
Locus ID 107
Cytogenetics 7p12.3
Protein Families Transmembrane, Druggable Genome
Protein Pathways Purine metabolism, Calcium signaling pathway, Chemokine signaling pathway, Oocyte meiosis, Vascular smooth muscle contraction, Gap junction, Long-term potentiation, GnRH signaling pathway, Progesterone-mediated oocyte maturation, Melanogenesis, Dilated cardiomyopathy
MW 123.3 kDa
Gene Summary This gene encodes a member of the of adenylate cyclase gene family that is primarily expressed in the brain. This protein is regulated by calcium/calmodulin concentration and may be involved in brain development. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)