MACROD2 (NM_080676) Human Tagged ORF Clone

CAT#: RC222689

Reviews ()
Write a review

MACROD2 (Myc-DDK-tagged)-Human MACRO domain containing 2 (MACROD2), transcript variant 1



  "NM_080676" in other vectors (6)

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "MACROD2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MACROD2
Synonyms C2orf133; C20orf133
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC222689 representing NM_080676
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAG
AAGAGAGACGCAAAGAATACCTAAGAGACTATATTCCCCTGAACAGCATTCTGTCATGGAAGGAGGAGAT
GAAGGGCAAGGGCCAAAATGATGAAGAAAATACTCAGGAAACATCCCAGGTGAAGAAAAGTTTGACTGAA
AAAGTTTCTCTCTATAGAGGTGACATCACATTGCTAGAGGTAGATGCTATAGTCAATGCCGCAAATGCCA
GTCTTCTTGGAGGAGGAGGTGTGGATGGCTGTATTCATAGAGCAGCCGGCCCCTGTTTGCTAGCTGAATG
TCGTAACCTGAATGGCTGTGATACTGGACATGCAAAAATCACATGTGGCTATGACCTTCCTGCAAAATAT
GTCATCCATACTGTAGGGCCAATAGCCAGGGGCCATATTAATGGTTCCCACAAGGAAGACCTTGCAAATT
GCTATAAATCATCTCTGAAGCTCGTGAAAGAAAATAACATCCGATCAGTTGCATTTCCCTGCATCTCAAC
AGGCATTTATGGCTTTCCCAACGAGCCTGCTGCAGTCATTGCCCTCAACACCATTAAGGAATGGCTTGCC
AAGAATCACCATGAGGTGGATCGGATCATTTTCTGTGTCTTCTTAGAAGTTGACTTCAAAATCTACAAAA
AGAAAATGAATGAGTTTTTCTCCGTAGACGATAATAATGAAGAAGAAGAGGATGTTGAAATGAAAGAAGA
TTCAGATGAGAACGGTCCAGAGGAGAAGCAAAGTGTGGAAGAAATGGAAGAGCAGAGCCAAGATGCAGAT
GGTGTCAACACTGTCACTGTGCCCGGCCCTGCTTCAGAAGAGGCAGTTGAAGACTGTAAAGATGAAGATT
TTGCAAAGGATGAAAATATTACAAAAGGCGGTGAAGTGACAGATCATTCTGTGCGTGACCAAGATCATCC
CGATGGACAAGAGAATGATTCAACGAAGAATGAAATAAAAATTGAAACAGAATCGCAGAGCTCATATATG
GAAACAGAAGAACTTTCATCAAACCAAGAAGATGCCGTGATTGTGGAGCAACCAGAAGTGATTCCATTAA
CAGAGGACCAAGAAGAAAAAGAAGGTGAAAAAGCTCCAGGCGAGGACACACCTAGGATGCCTGGGAAAAG
TGAAGGCTCCAGTGACCTAGAAAATACTCCAGGTCCTGATGCAGGGGCACAAGATGAAGCGAAGGAACAA
AGAAATGGAACTAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222689 representing NM_080676
Red=Cloning site Green=Tags(s)

MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDEENTQETSQVKKSLTE
KVSLYRGDITLLEVDAIVNAANASLLGGGGVDGCIHRAAGPCLLAECRNLNGCDTGHAKITCGYDLPAKY
VIHTVGPIARGHINGSHKEDLANCYKSSLKLVKENNIRSVAFPCISTGIYGFPNEPAAVIALNTIKEWLA
KNHHEVDRIIFCVFLEVDFKIYKKKMNEFFSVDDNNEEEEDVEMKEDSDENGPEEKQSVEEMEEQSQDAD
GVNTVTVPGPASEEAVEDCKDEDFAKDENITKGGEVTDHSVRDQDHPDGQENDSTKNEIKIETESQSSYM
ETEELSSNQEDAVIVEQPEVIPLTEDQEEKEGEKAPGEDTPRMPGKSEGSSDLENTPGPDAGAQDEAKEQ
RNGTK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_080676
ORF Size 1275 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_080676.5, NP_542407.2
RefSeq Size 4863 bp
RefSeq ORF 1278 bp
Locus ID 140733
UniProt ID A1Z1Q3
Cytogenetics 20p12.1
MW 47.2 kDa
Gene Summary The protein encoded by this gene is a deacetylase involved in removing ADP-ribose from mono-ADP-ribosylated proteins. The encoded protein has been shown to translocate from the nucleus to the cytoplasm upon DNA damage. [provided by RefSeq, May 2017]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.