TMEM16B(ANO2) (NM_020373) Human Tagged ORF Clone

CAT#: RC222601

ANO2 (Myc-DDK-tagged)-Human anoctamin 2 (ANO2)

Change vector?

USD 1,525


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TMEM16B(ANO2) (NM_020373) Human Tagged ORF Clone
Symbol ANO2
Synonyms C12orf3; TMEM16B
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC222601 representing NM_020373
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGAAGATATACCCCTGCTCCCTGGCTCCCCACGCCGGCTGAGCCCTCAGGCAGGGTCCAGAGGGG
GCCAGGGCCCCAAACATGGACAGCAGTGTCTCAAGATGCCAGGTCCCCGGGCCCCAGGTCTGCAGGGCGG
TTCCAACAGAGATCCTGGCCAGCCCTGCGGTGGAGAGAGCACCCGCAGCAGCTCTGTCATCAACAACTAT
CTGGATGCCAATGAGCCTGTGTCCTTGGAGGCCCGTCTTAGCCGCATGCACTTCCATGACAGTCAGAGGA
AGGTCGACTATGTACTTGCCTACCACTACCGGAAACGCGGGGTGCACCTGGCCCAAGGCTTCCCTGGCCA
CTCGCTGGCTATCGTCTCCAATGGGGAGACAGGCAAGGAGCCTCATGCTGGGGGCCCAGGTGACATTGAG
CTGGGACCGCTCGATGCCCTGGAGGAGGAGAGGAAGGAGCAGCGGGAGGAATTTGAGCACAATCTGATGG
AGGCTGGACTGGAGCTTGAGAAGGACTTGGAGAATAAAAGCCAGGGATCCATCTTTGTCCGGATACACGC
CCCGTGGCAGGTGCTGGCCAGAGAGGCAGAATTCTTGAAGATCAAAGTTCCTACCAAGAAAGAGATGTAC
GAGATCAAAGCAGGAGGCAGCATTGCAAAGAAGTTCAGCGCGGCTCTGCAGAAGCTGAGCTCGCACCTGC
AGCCCCGAGTTCCAGAACACAGCAACAACAAGATGAAAAACCTCTCCTACCCATTCTCCAGGGAGAAGAT
GTACCTGTACAACATCCAGGAAAAGGACACCTTCTTTGATAATGCCACCCGTAGCCGCATTGTGCACGAG
ATCCTGAAGCGCACAGCCTGCTCCCGAGCCAACAACACGATGGGTATTAACTCTCTGATCGCAAACAATA
TCTATGAGGCTGCCTACCCTCTTCATGACGGTGAATACGATAGTCCAGAGGACGATATGAATGACAGGAA
GCTGCTATATCAAGAATGGGCGCGCTATGGAGTGTTCTATAAGTTCCAACCTATTGACCTCATCAGAAAG
TATTTTGGAGAAAAAATTGGACTGTATTTTGCCTGGCTGGGATTATATACATCATTCCTCATCCCATCTT
CTGTAATTGGAGTGATTGTGTTTCTTTATGGATGTGCAACAATTGAAGAAGATATTCCCAGCAGAGAGAT
GTGTGACCAGCAGAATGCCTTCACCATGTGTCCCCTGTGTGACAAGTCCTGTGATTACTGGAACCTCAGC
TCAGCCTGTGGGACCGCGCAGGCCAGCCACCTGTTTGACAACCCTGCCACCGTCTTCTTCTCTATCTTCA
TGGCTCTGTGGGCTACCATGTTCCTGGAAAACTGGAAGAGGCTACAGATGCGACTGGGCTACTTTTGGGA
CCTGACTGGCATAGAAGAGGAAGAAGAACGTGCCCAGGAACATTCCAGGCCTGAGTATGAAACCAAAGTT
CGAGAGAAAATGCTAAAGGAGAGCAACCAGTCTGCTGTCCAGAAATTGGAAACAAACACGACGGAGTGTG
GCGATGAGGATGATGAAGATAAACTGACCTGGAAGGATCGTTTCCCAGGTTACCTGATGAACTTTGCCTC
CATCTTATTCATGATTGCCCTGACATTCTCAATCGTCTTTGGGGTGATAGTGTATCGAATAACAACTGCA
GCCGCTCTGTCTCTCAATAAGGCTACACGCTCCAATGTCCGGGTGACAGTGACAGCAACAGCAGTCATCA
TCAACCTCGTGGTCATCCTCATCCTGGACGAGATCTACGGCGCTGTGGCCAAGTGGCTCACCAAAATTGA
GGTTCCGAAAACAGAACAGACTTTTGAAGAGCGCCTGATCCTCAAAGCTTTCTTGCTCAAGTTTGTCAAT
GCCTACTCCCCCATCTTCTATGTGGCCTTTTTCAAAGGGAGGTTTGTGGGCAGGCCTGGAAGCTACGTCT
ATGTATTCGATGGTTACCGCATGGAAGAGTGTGCTCCAGGGGGCTGTCTCATGGAGCTCTGCATTCAGCT
CAGCATCATCATGTTGGGGAAGCAGTTGATCCAGAACAACATCTTTGAGATTGGAGTCCCGAAGCTAAAG
AAACTATTTCGAAAGCTGAAAGATGAGACCGAAGCTGGAGAAACTGACTCTGCCCATTCGAAACATCCAG
AGCAGTGGGACCTAGACTACAGCTTGGAACCATACACAGGACTGACTCCGGAGTACATGGAAATGATCAT
CCAGTTTGGTTTTGTCACCCTCTTCGTGGCCTCCTTTCCCCTGGCACCTGTGTTTGCCCTCCTCAACAAC
GTCATTGAAGTGCGGCTCGATGCAAAGAAGTTTGTTACAGAGCTGAGACGGCCGGATGCTGTAAGAACCA
AAGATATCGGAATCTGGTTTGACATTCTCTCTGGAATTGGCAAGTTCTCTGTTATCAGCAACGCTTTTGT
CATTGCGATCACCTCCGACTTTATCCCCCGCCTGGTGTACCAGTACTCCTACAGTCACAATGGGACTCTG
CACGGCTTTGTCAACCACACCCTCTCCTTTTTCAACGTCAGCCAGCTGAAGGAGGGGACGCAGCCAGAAA
ACTCACAGTTTGACCAGGAGGTTCAGTTCTGCAGGTTTAAGGATTACCGAGAGCCGCCATGGGCCCCGAA
CCCTTATGAGTTTTCGAAACAGTACTGGTTTATTCTGTCTGCCCGTCTGGCTTTTGTCATAATCTTCCAG
AACCTCGTGATGTTCCTGAGCGTCCTCGTGGACTGGATGATTCCAGACATCCCCACGGACATCAGCGACC
AGATCAAGAAAGAGAAGAGCTTATTAGTGGATTTCTTCCTGAAAGAGGAGCATGAGAAGCTCAAGCTGAT
GGATGAGCCGGCTCTGAGGAGCCCAGGAGGTGGGGATCGAAGCAGGAGCCGGGCAGCCAGCTCAGCACCT
TCAGGCCAAAGCCAGCTGGGCAGCATGATGTCGTCAGGCTCTCAGCACACCAATGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222601 representing NM_020373
Red=Cloning site Green=Tags(s)

MPEDIPLLPGSPRRLSPQAGSRGGQGPKHGQQCLKMPGPRAPGLQGGSNRDPGQPCGGESTRSSSVINNY
LDANEPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPGHSLAIVSNGETGKEPHAGGPGDIE
LGPLDALEEERKEQREEFEHNLMEAGLELEKDLENKSQGSIFVRIHAPWQVLAREAEFLKIKVPTKKEMY
EIKAGGSIAKKFSAALQKLSSHLQPRVPEHSNNKMKNLSYPFSREKMYLYNIQEKDTFFDNATRSRIVHE
ILKRTACSRANNTMGINSLIANNIYEAAYPLHDGEYDSPEDDMNDRKLLYQEWARYGVFYKFQPIDLIRK
YFGEKIGLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSREMCDQQNAFTMCPLCDKSCDYWNLS
SACGTAQASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEERAQEHSRPEYETKV
REKMLKESNQSAVQKLETNTTECGDEDDEDKLTWKDRFPGYLMNFASILFMIALTFSIVFGVIVYRITTA
AALSLNKATRSNVRVTVTATAVIINLVVILILDEIYGAVAKWLTKIEVPKTEQTFEERLILKAFLLKFVN
AYSPIFYVAFFKGRFVGRPGSYVYVFDGYRMEECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGVPKLK
KLFRKLKDETEAGETDSAHSKHPEQWDLDYSLEPYTGLTPEYMEMIIQFGFVTLFVASFPLAPVFALLNN
VIEVRLDAKKFVTELRRPDAVRTKDIGIWFDILSGIGKFSVISNAFVIAITSDFIPRLVYQYSYSHNGTL
HGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPNPYEFSKQYWFILSARLAFVIIFQ
NLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKLKLMDEPALRSPGGGDRSRSRAASSAP
SGQSQLGSMMSSGSQHTNV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_020373
ORF Size 2997 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020373.1, NM_020373.2, NP_065106
RefSeq Size 3717
RefSeq ORF 2996
Locus ID 57101
Cytogenetics 12p13.31
Protein Families Transmembrane
MW 113.3 kDa
Gene Summary ANO2 belongs to a family of calcium-activated chloride channels (CaCCs) (reviewed by Hartzell et al., 2009 [PubMed 19015192]).[supplied by OMIM, Jan 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations