ATG9A (NM_001077198) Human Tagged ORF Clone

CAT#: RC222568

Reviews ()
Write a review

ATG9A (Myc-DDK-tagged)-Human ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 1



  "NM_001077198" in other vectors (4)

Reconstitution Protocol

USD 768.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "ATG9A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ATG9A
Synonyms APG9L1; mATG9; MGD3208
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC222568 representing NM_001077198
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCAGTTTGACACTGAATACCAGCGCCTAGAGGCCTCCTATAGTGATTCACCCCCAGGGGAGGAGG
ACCTGTTGGTGCACGTCGCCGAGGGGAGCAAGTCACCTTGGCACCATATTGAAAACCTTGACCTCTTCTT
CTCTCGAGTTTATAATCTGCACCAGAAGAATGGCTTCACATGTATGCTCATCGGGGAGATCTTTGAGCTC
ATGCAGTTCCTCTTTGTGGTTGCCTTCACTACCTTCCTGGTCAGCTGCGTGGACTATGACATCCTATTTG
CCAACAAGATGGTGAACCACAGTCTTCACCCTACTGAACCCGTCAAGGTCACTCTGCCAGACGCCTTTTT
GCCTGCTCAAGTCTGTAGTGCCAGGATTCAGGAAAATGGCTCCCTTATCACCATCCTGGTCATTGCTGGT
GTCTTCTGGATCCACCGGCTTATCAAGTTCATCTATAACATTTGCTGCTACTGGGAGATCCACTCCTTCT
ACCTGCACGCTCTGCGCATCCCTATGTCTGCCCTTCCGTATTGCACGTGGCAAGAAGTGCAGGCCCGGAT
CGTGCAGACGCAGAAGGAGCACCAGATCTGCATCCACAAACGTGAGCTGACAGAACTGGACATCTACCAC
CGCATCCTCCGTTTCCAGAACTACATGGTGGCACTGGTTAACAAATCCCTCCTGCCTCTGCGCTTCCGCC
TGCCTGGCCTCGGGGAAGCTGTCTTCTTCACCCGTGGTCTCAAGTACAACTTTGAGCTGATCCTCTTCTG
GGGACCTGGCTCTCTGTTTCTCAATGAATGGAGCCTCAAGGCCGAGTACAAACGTGGGGGGCAACGGCTA
GAGCTGGCCCAGCGCCTCAGCAACCGCATCCTGTGGATTGGCATCGCTAACTTCCTGCTGTGCCCCCTCA
TCCTCATATGGCAAATCCTCTATGCCTTCTTCAGCTATGCTGAGGTGCTGAAGCGGGAGCCGGGGGCCCT
GGGAGCACGCTGCTGGTCACTCTATGGCCGCTGCTACCTCCGCCACTTCAACGAGCTGGAGCACGAGCTG
CAGTCCCGCCTCAACCGTGGCTACAAGCCCGCCTCCAAGTACATGAATTGCTTCTTGTCACCTCTTTTGA
CACTGCTGGCCAAGAATGGAGCCTTCTTCGCTGGCTCCATCCTGGCTGTGCTTATTGCCCTCACCATTTA
TGACGAAGATGTGTTGGCTGTGGAACATGTGCTGACCACCGTCACACTCCTGGGGGTCACCGTGACCGTG
TGCAGGTCCTTTATCCCGGACCAGCACATGGTGTTCTGCCCTGAGCAGCTGCTCCGCGTGATCCTCGCTC
ACATCCACTACATGCCTGACCACTGGCAGGGTAATGCCCACCGCTCGCAGACCCGGGACGAGTTTGCCCA
GCTCTTCCAGTACAAGGCAGTGTTCATTTTGGAAGAGTTGCTGAGCCCCATTGTCACACCCCTCATCCTC
ATCTTCTGCCTGCGCCCACGGGCCCTGGAGATTATAGACTTCTTCCGAAACTTCACCGTGGAGGTCGTTG
GTGTGGGAGATACCTGCTCCTTTGCTCAGATGGATGTTCGCCAGCATGGTCATCCCCAGTGGCTATCTGC
TGGGCAGACAGAGGCCTCAGTGTACCAGCAAGCTGAGGATGGAAAGACAGAGTTGTCACTCATGCACTTT
GCCATCACCAACCCTGGCTGGCAGCCACCACGTGAGAGCACAGCCTTCCTAGGCTTCCTCAAGGAGCAGG
TTCAGCGGGATGGAGCAGCTGCTAGCCTCGCCCAAGGGGGTCTGCTCCCTGAAAATGCCCTCTTTACGTC
TATCCAGTCCTTACAATCTGAGTCTGAGCCCCTGAGCCTTATCGCAAATGTGGTAGCTGGCTCATCCTGC
CGGGGCCCTCCACTGCCCAGAGACCTGCAGGGCTCCAGGCACAGGGCTGAAGTCGCCTCTGCCCTGCGCT
CCTTCTCCCCGCTGCAACCCGGGCAGGCGCCCACAGGCCGGGCTCACAGCACCATGACAGGCTCTGGGGT
GGATGCCAGGACAGCCAGCTCCGGGAGCAGCGTGTGGGAAGGACAGCTGCAGAGCCTGGTGCTGTCAGAA
TATGCATCCACAGAGATGAGCCTGCATGCCCTCTATATGCACCAGCTCCACAAGCAGCAGGCCCAGGCTG
AACCTGAGCGGCATGTATGGCACCGCCGGGAGAGTGATGAGAGTGGAGAAAGCGCCCCTGATGAAGGGGG
AGAGGGCGCCCGGGCCCCCCAGTCTATCCCTCGCTCTGCTAGCTATCCCTGTGCAGCACCCCGGCCTGGA
GCTCCTGAGACCACTGCCCTGCATGGGGGCTTCCAGAGGCGCTACGGTGGCATCACAGATCCTGGCACAG
TGCCCAGGGTTCCCTCTCATTTCTCTCGGCTGCCTCTTGGAGGGTGGGCAGAAGATGGGCAGTCGGCATC
AAGGCACCCTGAGCCCGTGCCCGAAGAGGGCTCGGAGGATGAGCTACCCCCTCAGGTGCACAAGGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222568 representing NM_001077198
Red=Cloning site Green=Tags(s)

MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFTCMLIGEIFEL
MQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQVCSARIQENGSLITILVIAG
VFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELDIYH
RILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRL
ELAQRLSNRILWIGIANFLLCPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHEL
QSRLNRGYKPASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTV
CRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLIL
IFCLRPRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTELSLMHF
AITNPGWQPPRESTAFLGFLKEQVQRDGAAASLAQGGLLPENALFTSIQSLQSESEPLSLIANVVAGSSC
RGPPLPRDLQGSRHRAEVASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLVLSE
YASTEMSLHALYMHQLHKQQAQAEPERHVWHRRESDESGESAPDEGGEGARAPQSIPRSASYPCAAPRPG
APETTALHGGFQRRYGGITDPGTVPRVPSHFSRLPLGGWAEDGQSASRHPEPVPEEGSEDELPPQVHKV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001077198
ORF Size 2517 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001077198.3
RefSeq Size 3795 bp
RefSeq ORF 2520 bp
Locus ID 79065
UniProt ID Q7Z3C6
Cytogenetics 2q35
Protein Families Transmembrane
MW 94.3 kDa
Gene Summary Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS), the nucleating site for formation of the sequestering vesicle. Cycles between a juxta-nuclear trans-Golgi network compartment and late endosomes. Nutrient starvation induces accumulation on autophagosomes. Starvation-dependent trafficking requires ULK1, ATG13 and SUPT20H.[UniProtKB/Swiss-Prot Function]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.