ATG9A (NM_001077198) Human Tagged ORF Clone

CAT#: RC222568

ATG9A (Myc-DDK-tagged)-Human ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 1

Change vector?

USD 1,288


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ATG9A (NM_001077198) Human Tagged ORF Clone
Symbol ATG9A
Synonyms APG9L1; mATG9; MGD3208
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC222568 representing NM_001077198
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCAGTTTGACACTGAATACCAGCGCCTAGAGGCCTCCTATAGTGATTCACCCCCAGGGGAGGAGG
ACCTGTTGGTGCACGTCGCCGAGGGGAGCAAGTCACCTTGGCACCATATTGAAAACCTTGACCTCTTCTT
CTCTCGAGTTTATAATCTGCACCAGAAGAATGGCTTCACATGTATGCTCATCGGGGAGATCTTTGAGCTC
ATGCAGTTCCTCTTTGTGGTTGCCTTCACTACCTTCCTGGTCAGCTGCGTGGACTATGACATCCTATTTG
CCAACAAGATGGTGAACCACAGTCTTCACCCTACTGAACCCGTCAAGGTCACTCTGCCAGACGCCTTTTT
GCCTGCTCAAGTCTGTAGTGCCAGGATTCAGGAAAATGGCTCCCTTATCACCATCCTGGTCATTGCTGGT
GTCTTCTGGATCCACCGGCTTATCAAGTTCATCTATAACATTTGCTGCTACTGGGAGATCCACTCCTTCT
ACCTGCACGCTCTGCGCATCCCTATGTCTGCCCTTCCGTATTGCACGTGGCAAGAAGTGCAGGCCCGGAT
CGTGCAGACGCAGAAGGAGCACCAGATCTGCATCCACAAACGTGAGCTGACAGAACTGGACATCTACCAC
CGCATCCTCCGTTTCCAGAACTACATGGTGGCACTGGTTAACAAATCCCTCCTGCCTCTGCGCTTCCGCC
TGCCTGGCCTCGGGGAAGCTGTCTTCTTCACCCGTGGTCTCAAGTACAACTTTGAGCTGATCCTCTTCTG
GGGACCTGGCTCTCTGTTTCTCAATGAATGGAGCCTCAAGGCCGAGTACAAACGTGGGGGGCAACGGCTA
GAGCTGGCCCAGCGCCTCAGCAACCGCATCCTGTGGATTGGCATCGCTAACTTCCTGCTGTGCCCCCTCA
TCCTCATATGGCAAATCCTCTATGCCTTCTTCAGCTATGCTGAGGTGCTGAAGCGGGAGCCGGGGGCCCT
GGGAGCACGCTGCTGGTCACTCTATGGCCGCTGCTACCTCCGCCACTTCAACGAGCTGGAGCACGAGCTG
CAGTCCCGCCTCAACCGTGGCTACAAGCCCGCCTCCAAGTACATGAATTGCTTCTTGTCACCTCTTTTGA
CACTGCTGGCCAAGAATGGAGCCTTCTTCGCTGGCTCCATCCTGGCTGTGCTTATTGCCCTCACCATTTA
TGACGAAGATGTGTTGGCTGTGGAACATGTGCTGACCACCGTCACACTCCTGGGGGTCACCGTGACCGTG
TGCAGGTCCTTTATCCCGGACCAGCACATGGTGTTCTGCCCTGAGCAGCTGCTCCGCGTGATCCTCGCTC
ACATCCACTACATGCCTGACCACTGGCAGGGTAATGCCCACCGCTCGCAGACCCGGGACGAGTTTGCCCA
GCTCTTCCAGTACAAGGCAGTGTTCATTTTGGAAGAGTTGCTGAGCCCCATTGTCACACCCCTCATCCTC
ATCTTCTGCCTGCGCCCACGGGCCCTGGAGATTATAGACTTCTTCCGAAACTTCACCGTGGAGGTCGTTG
GTGTGGGAGATACCTGCTCCTTTGCTCAGATGGATGTTCGCCAGCATGGTCATCCCCAGTGGCTATCTGC
TGGGCAGACAGAGGCCTCAGTGTACCAGCAAGCTGAGGATGGAAAGACAGAGTTGTCACTCATGCACTTT
GCCATCACCAACCCTGGCTGGCAGCCACCACGTGAGAGCACAGCCTTCCTAGGCTTCCTCAAGGAGCAGG
TTCAGCGGGATGGAGCAGCTGCTAGCCTCGCCCAAGGGGGTCTGCTCCCTGAAAATGCCCTCTTTACGTC
TATCCAGTCCTTACAATCTGAGTCTGAGCCCCTGAGCCTTATCGCAAATGTGGTAGCTGGCTCATCCTGC
CGGGGCCCTCCACTGCCCAGAGACCTGCAGGGCTCCAGGCACAGGGCTGAAGTCGCCTCTGCCCTGCGCT
CCTTCTCCCCGCTGCAACCCGGGCAGGCGCCCACAGGCCGGGCTCACAGCACCATGACAGGCTCTGGGGT
GGATGCCAGGACAGCCAGCTCCGGGAGCAGCGTGTGGGAAGGACAGCTGCAGAGCCTGGTGCTGTCAGAA
TATGCATCCACAGAGATGAGCCTGCATGCCCTCTATATGCACCAGCTCCACAAGCAGCAGGCCCAGGCTG
AACCTGAGCGGCATGTATGGCACCGCCGGGAGAGTGATGAGAGTGGAGAAAGCGCCCCTGATGAAGGGGG
AGAGGGCGCCCGGGCCCCCCAGTCTATCCCTCGCTCTGCTAGCTATCCCTGTGCAGCACCCCGGCCTGGA
GCTCCTGAGACCACTGCCCTGCATGGGGGCTTCCAGAGGCGCTACGGTGGCATCACAGATCCTGGCACAG
TGCCCAGGGTTCCCTCTCATTTCTCTCGGCTGCCTCTTGGAGGGTGGGCAGAAGATGGGCAGTCGGCATC
AAGGCACCCTGAGCCCGTGCCCGAAGAGGGCTCGGAGGATGAGCTACCCCCTCAGGTGCACAAGGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222568 representing NM_001077198
Red=Cloning site Green=Tags(s)

MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFTCMLIGEIFEL
MQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQVCSARIQENGSLITILVIAG
VFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELDIYH
RILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRL
ELAQRLSNRILWIGIANFLLCPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHEL
QSRLNRGYKPASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTV
CRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLIL
IFCLRPRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTELSLMHF
AITNPGWQPPRESTAFLGFLKEQVQRDGAAASLAQGGLLPENALFTSIQSLQSESEPLSLIANVVAGSSC
RGPPLPRDLQGSRHRAEVASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLVLSE
YASTEMSLHALYMHQLHKQQAQAEPERHVWHRRESDESGESAPDEGGEGARAPQSIPRSASYPCAAPRPG
APETTALHGGFQRRYGGITDPGTVPRVPSHFSRLPLGGWAEDGQSASRHPEPVPEEGSEDELPPQVHKV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001077198
ORF Size 2517 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001077198.1, NM_001077198.2, NP_001070666
RefSeq Size 3795
RefSeq ORF 2520
Locus ID 79065
Cytogenetics 2q35
Protein Families Transmembrane
MW 94.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations