ATG9A (NM_024085) Human Tagged ORF Clone

CAT#: RC222513

Reviews ()
Write a review

ATG9A (Myc-DDK-tagged)-Human ATG9 autophagy related 9 homolog A (S. cerevisiae) (ATG9A), transcript variant 2



  "NM_024085" in other vectors (6)

USD 930.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ATG9A (NM_024085) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ATG9A
Synonyms APG9L1; mATG9; MGD3208
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC222513 representing NM_024085
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCAGTTTGACACTGAATACCAGCGCCTAGAGGCCTCCTATAGTGATTCACCCCCAGGGGAGGAGG
ACCTGTTGGTGCACGTCGCCGAGGGGAGCAAGTCACCTTGGCACCATATTGAAAACCTTGACCTCTTCTT
CTCTCGAGTTTATAATCTGCACCAGAAGAATGGCTTCACATGTATGCTCATCGGGGAGATCTTTGAGCTC
ATGCAGTTCCTCTTTGTGGTTGCCTTCACTACCTTCCTGGTCAGCTGCGTGGACTATGACATCCTATTTG
CCAACAAGATGGTGAACCACAGTCTTCACCCTACTGAACCCGTCAAGGTCACTCTGCCAGACGCCTTTTT
GCCTGCTCAAGTCTGTAGTGCCAGGATTCAGGAAAATGGCTCCCTTATCACCATCCTGGTCATTGCTGGT
GTCTTCTGGATCCACCGGCTTATCAAGTTCATCTATAACATTTGCTGCTACTGGGAGATCCACTCCTTCT
ACCTGCACGCTCTGCGCATCCCTATGTCTGCCCTTCCGTATTGCACGTGGCAAGAAGTGCAGGCCCGGAT
CGTGCAGACGCAGAAGGAGCACCAGATCTGCATCCACAAACGTGAGCTGACAGAACTGGACATCTACCAC
CGCATCCTCCGTTTCCAGAACTACATGGTGGCACTGGTTAACAAATCCCTCCTGCCTCTGCGCTTCCGCC
TGCCTGGCCTCGGGGAAGCTGTCTTCTTCACCCGTGGTCTCAAGTACAACTTTGAGCTGATCCTCTTCTG
GGGACCTGGCTCTCTGTTTCTCAATGAATGGAGCCTCAAGGCCGAGTACAAACGTGGGGGGCAACGGCTA
GAGCTGGCCCAGCGCCTCAGCAACCGCATCCTGTGGATTGGCATCGCTAACTTCCTGCTGTGCCCCCTCA
TCCTCATATGGCAAATCCTCTATGCCTTCTTCAGCTATGCTGAGGTGCTGAAGCGGGAGCCGGGGGCCCT
GGGAGCACGCTGCTGGTCACTCTATGGCCGCTGCTACCTCCGCCACTTCAACGAGCTGGAGCACGAGCTG
CAGTCCCGCCTCAACCGTGGCTACAAGCCCGCCTCCAAGTACATGAATTGCTTCTTGTCACCTCTTTTGA
CACTGCTGGCCAAGAATGGAGCCTTCTTCGCTGGCTCCATCCTGGCTGTGCTTATTGCCCTCACCATTTA
TGACGAAGATGTGTTGGCTGTGGAACATGTGCTGACCACCGTCACACTCCTGGGGGTCACCGTGACCGTG
TGCAGGTCCTTTATCCCGGACCAGCACATGGTGTTCTGCCCTGAGCAGCTGCTCCGCGTGATCCTCGCTC
ACATCCACTACATGCCTGACCACTGGCAGGGTAATGCCCACCGCTCGCAGACCCGGGACGAGTTTGCCCA
GCTCTTCCAGTACAAGGCAGTGTTCATTTTGGAAGAGTTGCTGAGCCCCATTGTCACACCCCTCATCCTC
ATCTTCTGCCTGCGCCCACGGGCCCTGGAGATTATAGACTTCTTCCGAAACTTCACCGTGGAGGTCGTTG
GTGTGGGAGATACCTGCTCCTTTGCTCAGATGGATGTTCGCCAGCATGGTCATCCCCAGTGGCTATCTGC
TGGGCAGACAGAGGCCTCAGTGTACCAGCAAGCTGAGGATGGAAAGACAGAGTTGTCACTCATGCACTTT
GCCATCACCAACCCTGGCTGGCAGCCACCACGTGAGAGCACAGCCTTCCTAGGCTTCCTCAAGGAGCAGG
TTCAGCGGGATGGAGCAGCTGCTAGCCTCGCCCAAGGGGGTCTGCTCCCTGAAAATGCCCTCTTTACGTC
TATCCAGTCCTTACAATCTGAGTCTGAGCCCCTGAGCCTTATCGCAAATGTGGTAGCTGGCTCATCCTGC
CGGGGCCCTCCACTGCCCAGAGACCTGCAGGGCTCCAGGCACAGGGCTGAAGTCGCCTCTGCCCTGCGCT
CCTTCTCCCCGCTGCAACCCGGGCAGGCGCCCACAGGCCGGGCTCACAGCACCATGACAGGCTCTGGGGT
GGATGCCAGGACAGCCAGCTCCGGGAGCAGCGTGTGGGAAGGACAGCTGCAGAGCCTGGTGCTGTCAGAA
TATGCATCCACAGAGATGAGCCTGCATGCCCTCTATATGCACCAGCTCCACAAGCAGCAGGCCCAGGCTG
AACCTGAGCGGCATGTATGGCACCGCCGGGAGAGTGATGAGAGTGGAGAAAGCGCCCCTGATGAAGGGGG
AGAGGGCGCCCGGGCCCCCCAGTCTATCCCTCGCTCTGCTAGCTATCCCTGTGCAGCACCCCGGCCTGGA
GCTCCTGAGACCACCGCCCTGCATGGGGGCTTCCAGAGGCGCTACGGTGGCATCACAGATCCTGGCACAG
TGCCCAGGGTTCCCTCTCATTTCTCTCGGCTGCCTCTTGGAGGGTGGGCAGAAGATGGGCAGTCGGCATC
AAGGCACCCTGAGCCCGTGCCCGAAGAGGGCTCGGAGGATGAGCTACCCCCTCAGGTGCACAAGGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222513 representing NM_024085
Red=Cloning site Green=Tags(s)

MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFTCMLIGEIFEL
MQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQVCSARIQENGSLITILVIAG
VFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELDIYH
RILRFQNYMVALVNKSLLPLRFRLPGLGEAVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRL
ELAQRLSNRILWIGIANFLLCPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHEL
QSRLNRGYKPASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTV
CRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVFILEELLSPIVTPLIL
IFCLRPRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQWLSAGQTEASVYQQAEDGKTELSLMHF
AITNPGWQPPRESTAFLGFLKEQVQRDGAAASLAQGGLLPENALFTSIQSLQSESEPLSLIANVVAGSSC
RGPPLPRDLQGSRHRAEVASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLVLSE
YASTEMSLHALYMHQLHKQQAQAEPERHVWHRRESDESGESAPDEGGEGARAPQSIPRSASYPCAAPRPG
APETTALHGGFQRRYGGITDPGTVPRVPSHFSRLPLGGWAEDGQSASRHPEPVPEEGSEDELPPQVHKV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024085
ORF Size 2517 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024085.2, NM_024085.3, NM_024085.4, NP_076990.3
RefSeq Size 3816 bp
RefSeq ORF 2520 bp
Locus ID 79065
Cytogenetics 2q35
Domains APG9
Protein Families Transmembrane
MW 94.3 kDa

Citations (2)

Other Versions

Other products for "ATG9A"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-ATG9A Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools