Proprotein Convertase 2 (PCSK2) (NM_002594) Human Tagged ORF Clone

CAT#: RC222498

Reviews ()
Write a review

PCSK2 (Myc-DDK-tagged)-Human proprotein convertase subtilisin/kexin type 2 (PCSK2), transcript variant 1



  "NM_002594" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 869.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PCSK2
Synonyms NEC-2; NEC 2; NEC2; PC2; SPC2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC222498 representing NM_002594
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGGTGGTTGTGTCTCCCAGTGGAAGGCGGCCGCCGGGTTCCTCTTCTGTGTCATGGTTTTTGCAT
CTGCTGAGCGACCGGTCTTCACGAATCATTTTCTTGTGGAGTTGCATAAAGGGGGAGAGGACAAAGCTCG
CCAAGTTGCAGCAGAACACGGCTTTGGAGTCCGAAAGCTTCCCTTTGCTGAAGGTCTGTACCACTTTTAT
CACAATGGCCTTGCAAAGGCCAAGAGAAGACGCAGCCTACACCACAAGCAGCAGCTGGAGAGAGACCCCA
GGGTAAAGATGGCTTTGCAGCAGGAAGGATTTGACCGAAAAAAGCGAGGTTACAGAGACATCAATGAGAT
CGACATCAACATGAACGATCCTCTTTTTACAAAGCAGTGGTATCTGATCAATACTGGGCAAGCTGATGGC
ACTCCTGGCCTTGATTTGAATGTGGCTGAAGCCTGGGAGCTGGGATACACAGGGAAAGGTGTTACCATTG
GAATTATGGATGATGGGATTGACTATCTCCACCCGGACCTGGCCTCCAACTATAATGCCGAAGCAAGTTA
CGACTTCAGCAGCAACGACCCCTATCCTTACCCTCGGTACACAGATGACTGGTTTAACAGCCACGGGACC
CGATGTGCAGGAGAAGTTTCTGCTGCCGCCAACAACAATATCTGTGGAGTTGGAGTAGCATACAACTCCA
AGGTTGCAGGCATCCGGATGCTGGACCAGCCATTCATGACAGACATCATCGAGGCCTCCTCCATCAGTCA
TATGCCACAGCTGATTGACATCTACAGCGCCAGCTGGGGCCCCACAGACAACGGCAAGACAGTGGATGGG
CCCCGGGAGCTCACGCTGCAGGCCATGGCCGATGGCGTGAACAAGGGCCGCGGCGGCAAAGGCAGCATCT
ACGTGTGGGCCTCCGGGGACGGCGGCAGCTATGACGACTGCAACTGCGACGGCTACGCCTCCAGCATGTG
GACCATCTCCATCAACTCAGCCATCAACGACGGCAGGACTGCCCTGTACGACGAGAGCTGCTCTTCCACC
TTGGCTTCCACCTTCAGCAACGGGAGGAAAAGGAACCCCGAGGCCGGTGTGGCAACCACAGATTTGTACG
GCAACTGCACTCTGAGGCATTCTGGGACATCTGCAGCTGCCCCCGAGGCAGCTGGTGTGTTTGCACTGGC
TCTGGAGGCTAACCTGGGTCTGACCTGGCGGGACATGCAGCATCTGACTGTGCTCACCTCCAAACGGAAC
CAGCTTCACGACGAGGTCCATCAGTGGCGGCGCAATGGGGTCGGCCTGGAATTTAATCACCTCTTTGGCT
ACGGGGTCCTTGATGCAGGTGCCATGGTGAAAATGGCTAAAGACTGGAAAACCGTGCCTGAGAGATTCCA
CTGTGTGGGAGGCTCCGTGCAGGACCCTGAGAAAATACCATCCACTGGCAAGTTGGTGCTGACACTCACA
ACCGACGCCTGTGAGGGGAAGGAAAATTTTGTCCGCTACCTGGAGCATGTCCAGGCTGTCATCACGGTCA
ACGCAACCAGAAGAGGAGACCTGAACATCAACATGACTTCCCCTATGGGCACCAAGTCCATTTTGCTGAG
CCGGCGTCCAAGGGATGACGACTCCAAGGTGGGCTTTGACAAGTGGCCTTTCATGACCACTCACACGTGG
GGGGAAGACGCCCGAGGCACCTGGACCCTGGAGCTGGGATTTGTCGGCAGCGCCCCGCAGAAGGGGGTGC
TGAAGGAGTGGACCCTGATGCTGCATGGCACTCAGAGTGCCCCGTACATCGACCAGGTGGTGCGGGATTA
CCAGTCCAAGTTGGCCATGTCCAAGAAAGAGGAGCTGGAGGAAGAGCTGGACGAAGCCGTGGAGAGAAGC
CTGAAAAGCATCCTTAACAAGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222498 representing NM_002594
Red=Cloning site Green=Tags(s)

MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFY
HNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADG
TPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGT
RCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDG
PRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSST
LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLT
TDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTW
GEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKEELEEELDEAVERS
LKSILNKN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002594
ORF Size 1914 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002594.5
RefSeq Size 4745 bp
RefSeq ORF 1917 bp
Locus ID 5126
UniProt ID P16519
Cytogenetics 20p12.1
Domains Peptidase_S8, P
Protein Families Druggable Genome, Protease, Secreted Protein
MW 70.57 kDa
Gene Summary This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The protein undergoes an initial autocatalytic processing event and interacts with a neuroendocrine secretory protein in the ER, exits the ER and sorts to secretory granules, where it is cleaved and catalytically activated during intracellular transport. The encoded protease is packaged into and activated in dense core secretory granules and expressed in the neuroendocrine system and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. It functions in the proteolytic activation of polypeptide hormones and neuropeptides precursors. Single nucleotide polymorphisms in this gene may increase susceptibility to myocardial infarction and type 2 diabetes. This gene may also play a role in tumor development and progression. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2014]

Other Versions

Other products for "PCSK2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


Rabbit polyclonal PCSK2 Antibody (N-term)
    • 400 ul

USD 512.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.