Myelin oligodendrocyte glycoprotein (MOG) (NM_206809) Human Tagged ORF Clone

CAT#: RC222455

MOG (Myc-DDK-tagged)-Human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha1

ORF Plasmid: DDK GFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro



  "NM_206809" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MOG
Synonyms BTN6; BTNL11; MOGIG2; NRCLP7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC222455 representing NM_206809
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAAGCTTATCAAGACCCTCTCTGCCCAGCTGCCTCTGCTCCTTCCTCCTCCTCCTCCTCCTCCAAG
TGTCTTCCAGCTATGCAGGGCAGTTCAGAGTGATAGGACCAAGACACCCTATCCGGGCTCTGGTCGGGGA
TGAAGTGGAATTGCCATGTCGCATATCTCCTGGGAAGAACGCTACAGGCATGGAGGTGGGGTGGTACCGC
CCCCCCTTCTCTAGGGTGGTTCATCTCTACAGAAATGGCAAGGACCAAGATGGAGACCAGGCACCTGAAT
ATCGGGGCCGGACAGAGCTGCTGAAAGATGCTATTGGTGAGGGAAAGGTGACTCTCAGGATCCGGAATGT
AAGGTTCTCAGATGAAGGAGGTTTCACCTGCTTCTTCCGAGATCATTCTTACCAAGAGGAGGCAGCAATG
GAATTGAAAGTAGAAGATCCTTTCTACTGGGTGAGCCCTGGAGTGCTGGTTCTCCTCGCGGTGCTGCCTG
TGCTCCTCCTGCAGATCACTGTTGGCCTCATCTTCCTCTGCCTGCAGTACAGACTGAGAGGAAAACTTCG
AGCAGAGATAGAGAATCTCCACCGGACTTTTGATCCCCACTTTCTGAGGGTGCCCTGCTGGAAGATAACC
CTGTTTGTAATTGTGCCGGTTCTTGGACCCTTGGTTGCCTTGATCATCTGCTACAACTGGCTACATCGAA
GACTAGCAGGGCAATTCCTTGAAGAGCTACGAAATCCCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222455 representing NM_206809
Red=Cloning site Green=Tags(s)

MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYR
PPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAM
ELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKIT
LFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_206809
ORF Size 741 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_206809.4
RefSeq Size 2119 bp
RefSeq ORF 744 bp
Locus ID 4340
UniProt ID Q16653
Cytogenetics 6p22.1
Protein Families Transmembrane
MW 25.1 kDa
Gene Summary The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.