ADAM9 (NM_003816) Human Tagged ORF Clone

CAT#: RC222453

Reviews ()
Write a review
  • TrueORF®

ADAM9 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 9 (ADAM9), transcript variant 1



  "NM_003816" in other vectors (6)

USD 910.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ADAM9 (NM_003816) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ADAM9
Synonyms CORD9; MCMP; MDC9; Mltng
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC222453 representing NM_003816
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTCTGGCGCGCGCTTTCCCTCGGGGACCCTTCGTGTCCGGTGGTTGCTGTTGCTTGGCCTGGTGG
GCCCAGTCCTCGGTGCGGCGCGGCCAGGCTTTCAACAGACCTCACATCTTTCTTCTTATGAAATTATAAC
TCCTTGGAGATTAACTAGAGAAAGAAGAGAAGCCCCTAGGCCCTATTCAAAACAAGTATCTTATGTTATT
CAGGCTGAAGGAAAAGAGCATATTATTCACTTGGAAAGGAACAAAGACCTTTTGCCTGAAGATTTTGTGG
TTTATACTTACAACAAGGAAGGGACTTTAATCACTGACCATCCCAATATACAGAATCATTGTCATTATCG
GGGCTATGTGGAGGGAGTTCATAATTCATCCATTGCTCTTAGCGACTGTTTTGGACTCAGAGGATTGCTG
CATTTAGAGAATGCGAGTTATGGGATTGAACCCCTGCAGAACAGCTCTCATTTTGAGCACATCATTTATC
GAATGGATGATGTCTACAAAGAGCCTCTGAAATGTGGAGTTTCCAACAAGGATATAGAGAAAGAAACTGC
AAAGGATGAAGAGGAAGAGCCTCCCAGCATGACTCAGCTACTTCGAAGAAGAAGAGCTGTCTTGCCACAG
ACCCGGTATGTGGAGCTGTTCATTGTCGTAGACAAGGAAAGGTATGACATGATGGGAAGAAATCAGACTG
CTGTGAGAGAAGAGATGATTCTCCTGGCAAACTACTTGGATAGTATGTATATTATGTTAAATATTCGAAT
TGTGCTAGTTGGACTGGAGATTTGGACCAATGGAAACCTGATCAACATAGTTGGGGGTGCTGGTGATGTG
CTGGGGAACTTCGTGCAGTGGCGGGAAAAGTTTCTTATCACACGTCGGAGACATGACAGTGCACAGCTAG
TTCTAAAGAAAGGTTTTGGTGGAACTGCAGGAATGGCATTTGTGGGAACAGTGTGTTCAAGGAGCCACGC
AGGCGGGATTAATGTGTTTGGACAAATCACTGTGGAGACATTTGCTTCCATTGTTGCTCATGAATTGGGT
CATAATCTTGGAATGAATCACGATGATGGGAGAGATTGTTCCTGTGGAGCAAAGAGCTGCATCATGAATT
CAGGAGCATCGGGTTCCAGAAACTTTAGCAGTTGCAGTGCAGAGGACTTTGAGAAGTTAACTTTAAATAA
AGGAGGAAACTGCCTTCTTAATATTCCAAAGCCTGATGAAGCCTATAGTGCTCCCTCCTGTGGTAATAAG
TTGGTGGACGCTGGGGAAGAGTGTGACTGTGGTACTCCAAAGGAATGTGAATTGGACCCTTGCTGCGAAG
GAAGTACCTGTAAGCTTAAATCATTTGCTGAGTGTGCATATGGTGACTGTTGTAAAGACTGTCGGTTCCT
TCCAGGAGGTACTTTATGCCGAGGAAAAACCAGTGAGTGTGATGTTCCAGAGTACTGCAATGGTTCTTCT
CAGTTCTGTCAGCCAGATGTTTTTATTCAGAATGGATATCCTTGCCAGAATAACAAAGCCTATTGCTACA
ACGGCATGTGCCAGTATTATGATGCTCAATGTCAAGTCATCTTTGGCTCAAAAGCCAAGGCTGCCCCCAA
AGATTGTTTCATTGAAGTGAATTCTAAAGGTGACAGATTTGGCAATTGTGGTTTCTCTGGCAATGAATAC
AAGAAGTGTGCCACTGGGAATGCTTTGTGTGGAAAGCTTCAGTGTGAGAATGTACAAGAGATACCTGTAT
TTGGAATTGTGCCTGCTATTATTCAAACGCCTAGTCGAGGCACCAAATGTTGGGGTGTGGATTTCCAGCT
AGGATCAGATGTTCCAGATCCTGGGATGGTTAACGAAGGCACAAAATGTGGTGCTGGAAAGATCTGTAGA
AACTTCCAGTGTGTAGATGCTTCTGTTCTGAATTATGACTGTGATGTTCAGAAAAAGTGTCATGGACATG
GGGTATGTAATAGCAATAAGAATTGTCACTGTGAAAATGGCTGGGCTCCCCCAAATTGTGAGACTAAAGG
ATACGGAGGAAGTGTGGACAGTGGACCTACATACAATGAAATGAATACTGCATTGAGGGACGGACTTCTG
GTCTTCTTCTTCCTAATTGTTCCCCTTATTGTCTGTGCTATTTTTATCTTCATCAAGAGGGATCAACTGT
GGAGAAGCTACTTCAGAAAGAAGAGATCACAAACATATGAGTCAGATGGCAAAAATCAAGCAAACCCTTC
TAGACAGCCGGGGAGTGTTCCTCGACATGTTTCTCCAGTGACACCTCCCAGAGAAGTTCCTATATATGCA
AACAGATTTGCAGTACCAACCTATGCAGCCAAGCAACCTCAGCAGTTCCCATCAAGGCCACCTCCACCAC
AACCGAAAGTATCATCTCAGGGAAACTTAATTCCTGCCCGTCCTGCTCCTGCACCTCCTTTATATAGTTC
CCTCACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222453 representing NM_003816
Red=Cloning site Green=Tags(s)

MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVI
QAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLL
HLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQ
TRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDV
LGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELG
HNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNK
LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSECDVPEYCNGSS
QFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGFSGNEY
KKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICR
NFQCVDASVLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLL
VFFFLIVPLIVCAIFIFIKRDQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYA
NRFAVPTYAAKQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003816
ORF Size 2457 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003816.1, NM_003816.2, NP_003807.1
RefSeq Size 4111 bp
RefSeq ORF 2460 bp
Locus ID 8754
Cytogenetics 8p11.22
Domains Reprolysin, DISIN, Pep_M12B_propep, ACR
Protein Families Druggable Genome, Protease, Secreted Protein, Transmembrane
MW 90.56 kDa
Gene Summary This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jul 2010]

Citations (1)

Other Versions

Other products for "ADAM9"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit anti-ADAM9 Polyclonal Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools