PDI (PDIA2) (NM_006849) Human Tagged ORF Clone

CAT#: RC222382

Reviews ()
Write a review

PDIA2 (Myc-DDK-tagged)-Human protein disulfide isomerase family A, member 2 (PDIA2)



  "NM_006849" in other vectors (7)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PDIA2
Synonyms PDA2; PDI; PDIP; PDIR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC222382 representing NM_006849
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCGCCAGCTTCTGCCTGTACTGCTGCTGCTGCTGCTCAGGGCTTCGTGCCCATGGGGTCAGGAAC
AGGGAGCGAGGAGCCCCTCGGAGGAGCCTCCAGAGGAGGAAATCCCCAAGGAGGATGGGATCTTGGTGCT
GAGCCGCCACACCCTGGGCCTGGCCCTGCGGGAGCACCCTGCCCTGCTGGTGGAATTCTATGCCCCGTGG
TGTGGGCACTGCCAGGCCCTGGCCCCCGAGTACAGCAAGGCAGCTGCCGTGCTCGCGGCCGAGTCAATGG
TGGTCACGCTGGCCAAGGTGGATGGGCCCGCGCAGCGCGAGCTGGCTGAGGAGTTTGGTGTGACGGAGTA
CCCTACGCTCAAGTTCTTCCGCAATGGGAACCGCACGCACCCGGAGGAGTACACAGGACCACGGGACGCT
GAGGGCATTGCCGAGTGGCTGCGACGGCGGGTGGGGCCCAGTGCCATGCGGCTGGAGGACGAGGCGGCCG
CCCAGGCGCTGATCGGTGGCCGGGACCTAGTGGTCATTGGCTTCTTCCAGGACCTGCAGGACGAGGACGT
GGCCACCTTCTTGGCCTTGGCCCAGGACGCCCTGGACATGACCTTTGGCCTCACAGACCGGCCGCGGCTC
TTTCAGCAGTTTGGCCTCACCAAGGACACTGTGGTTCTCTTCAAGAAGTTTGATGAGGGGCGGGCAGACT
TCCCCGTGGACGAGGAGCTTGGCCTGGACCTGGGGGATCTGTCGCGCTTCCTGGTCACACACAGCATGCG
CCTGGTCACGGAGTTCAACAGCCAGACGTCTGCCAAGATCTTCGCGGCCAGGATCCTCAACCACCTGCTG
CTGTTTGTCAACCAGACGCTGGCTGCGCACCGGGAGCTCCTAGCGGGCTTTGGGGAGGCAGCTCCCCGCT
TCCGGGGGCAGGTGCTGTTCGTGGTGGTGGACGTGGCGGCCGACAATGAGCACGTGCTGCAGTACTTTGG
ACTCAAGGCTGAGGCAGCCCCCACTCTGCGCTTGGTCAACCTTGAAACCACTAAGAAGTATGCGCCTGTG
GATGGGGGCCCTGTCACCGCAGCGTCCATCACTGCTTTCTGCCATGCAGTCCTCAACGGCCAAGTCAAGC
CCTATCTCCTGAGCCAGGAGATACCCCCTGATTGGGATCAGCGGCCAGTTAAGACCCTCGTGGGCAAGAA
TTTTGAGCAGGTGGCTTTTGACGAAACCAAGAATGTGTTTGTCAAGTTCTATGCCCCGTGGTGCACCCAC
TGCAAGGAGATGGCCCCTGCCTGGGAGGCATTGGCTGAGAAGTACCAAGACCACGAGGACATCATCATTG
CTGAGCTGGATGCCACGGCCAACGAGCTGGATGCCTTCGCTGTGCACGGCTTCCCTACTCTCAAGTACTT
CCCAGCAGGGCCAGGTCGGAAGGTGATTGAATACAAAAGCACCAGGGACCTGGAGACTTTCTCCAAGTTC
CTGGACAACGGGGGCGTGCTGCCCACGGAGGAGCCCCCGGAGGAGCCAGCAGCCCCGTTCCCGGAGCCAC
CGGCCAACTCCACTATGGGGTCCAAGGAGGAACTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222382 representing NM_006849
Red=Cloning site Green=Tags(s)

MSRQLLPVLLLLLLRASCPWGQEQGARSPSEEPPEEEIPKEDGILVLSRHTLGLALREHPALLVEFYAPW
CGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDA
EGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRL
FQQFGLTKDTVVLFKKFDEGRADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLL
LFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPV
DGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTH
CKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKF
LDNGGVLPTEEPPEEPAAPFPEPPANSTMGSKEEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006849
ORF Size 1575 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006849.4
RefSeq Size 1726 bp
RefSeq ORF 1578 bp
Locus ID 64714
UniProt ID Q13087
Cytogenetics 16p13.3
Protein Families Druggable Genome
MW 58 kDa
Gene Summary This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, two catalytically active thioredoxin (TRX) domains, two TRX-like domains and a C-terminal ER-retention sequence. The protein plays a role in the folding of nascent proteins in the endoplasmic reticulum by forming disulfide bonds through its thiol isomerase, oxidase, and reductase activity. The encoded protein also possesses estradiol-binding activity and can modulate intracellular estradiol levels. [provided by RefSeq, Sep 2017]

Other Versions

Other products for "PDIA2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


Anti-PDIA2 Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.