PION(GSAP) (NM_017439) Human Tagged ORF Clone

CAT#: RC222360

PION (Myc-DDK-tagged)-Human pigeon homolog (Drosophila) (PION)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,309.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name PION(GSAP) (NM_017439) Human Tagged ORF Clone
Symbol GSAP
Synonyms PION; PION
Vector pCMV6-Entry
Sequence Data
>RC222360 representing NM_017439
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTTCGCCTGGTCGCCGACTTCGACCTCGGGAAGGACGTGCTCCCGTGGTTGCGGGCGCAGCGGG
CAGTGTCGGAGGCCAGCGGGGCCGGAAGCGGCGGCGCAGATGTTTTAGAAAACGATTATGAGAGCTTACA
TGTATTAAATGTTGAAAGAAATGGAAATATTATTTATACCTATAAGGATGATAAGGGAAATGTCGTCTTT
GGATTATATGATTGTCAAACCAGACAAAATGAGCTTCTATATACCTTTGAGAAAGACTTGCAAGTTTTCA
GTTGCTCTGTCAACAGTGAAAGGACTTTGCTTGCTGCAAGTTTAGTTCAGTCTACTAAAGAAGGAAAAAG
GAACGAACTTCAACCAGGATCAAAGTGCTTGACTTTGTTGGTTGAAATCCACCCTGTTAACAATGTGAAG
GTTCTAAAGGCTGTGGATAGCTATATTTGGGTTCAGTTTCTCTACCCACATATTGAAAGTCATCCTCTTC
CAGAGAACCATCTGTTACTGATTTCAGAAGAGAAATATATTGAACAATTTCGTATCCATGTCGCCCAAGA
AGATGGAAATAGAGTGGTGATTAAAAATTCTGGCCATCTCCCAAGAGACAGAATAGCTGAGGATTTCGTT
TGGGCTCAGTGGGATATGTCAGAACAGAGATTATATTACATTGACCTGAAGAAATCAAGGAGTATCTTAA
AATGTATCCAGTTTTATGCTGATGAGAGCTATAACTTAATGTTTGAAGTACCCTTGGACATATCATTAAG
CAACTCAGGATTTAAACTTGTCAACTTTGGATGTGATTATCATCAATACCGAGATAAATTTTCCAAACAC
CTGACTCTGTGTGTTTTTACCAACCATACAGGAAGTTTGTGTGTATGTTACAGCCCGAAGTGTGCCTCTT
GGGGACAAATCACATATTCAGTGTTTTACATTCATAAAGGACACAGCAAGACCTTCACCACTTCTCTTGA
GAATGTTGGGTCACACATGACAAAGGGCATTACTTTTCTCAACCTTGACTATTATGTGGCTGTTTACTTA
CCTGGTCATTTCTTCCACCTACTTAATGTTCAACATCCAGACCTGATCTGCCACAATCTCTTTCTGACAG
GAAATAATGAAATGATTGATATGCTACCTCATTGCCCTTTACAGTCATTGTCAGGGTCCCTGGTATTGGA
TTGTTGTTCTGGAAAGCTCTATAGAGCACTGCTCAGCCAGTCGTCTTTATTACAGCTTCTGCAGAACACT
TGCTTAGACTGTGAGAAGATGGCTGCGTTGCACTGCGCGCTCTACTGCGGTCAAGGTGCGCAGTTCCTGG
AAGCCCAGATTATTCAGTGGATTTCTGAGAATGTCTCTGCCTGCCATTCATTTGACCTCATTCAGGAATT
TATAATTGCTTCTTCATACTGGAGTGTATATTCAGAGACAAGTAACATGGACAAACTATTGCCACATTCC
TCAGTGCTCACTTGGAATACAGAAATTCCTGGAATAACTCTTGTGACAGAAGACATTGCATTGCCTCTTA
TGAAGGTGCTCAGCTTTAAGGGCTACTGGGAAAAACTGAACTCCAACCTAGAATATGTTAAGTACGCCAA
GCCACACTTCCACTATAACAACAGTGTGGTCAGGAGAGAGTGGCACAACCTGATCTCTGAAGAGAAAACA
GGAAAAAGAAGGTCTGCGGCATACGTGAGGAATATTCTTGATAATGCAGTAAAGGTGATTTCTAACCTAG
AAGCAAGAAATTTGGGGCCAAGATTAACACCCCTCCTGCAGGAGGAAGACAGCCACCAGCGGCTGCTCAT
GGGGCTGATGGTGTCTGAGCTAAAAGACCATTTTTTGAGACACCTACAGGGTGTAGAAAAGAAGAAAATT
GAACAGATGGTTCTGGACTACATTTCAAAACTGCTGGATCTCATTTGCCACATCGTAGAAACCAATTTGA
GGAAACATAATCTTCATTCCTGGGTTCTCCACTTCAATAGTCGTGGCAGTGCTGCTGAATTTGCAGTTTT
TCACATCATGACCAGGATTCTGGAAGCTACAAACAGTTTGTTTTTACCTCTGCCTCCTGGTTTTCATACT
CTGCACACCATCCTCGGGGTCCAGTGTCTCCCTTTGCATAACCTGCTGCATTGCATTGACAGTGGAGTGT
TGCTTCTCACTGAAACAGCTGTCATAAGGCTCATGAAAGATCTGGATAATACAGAGAAAAATGAAAAACT
GAAATTCAGTATCATTGTGCGGCTTCCTCCGCTTATTGGGCAGAAGATTTGTAGACTTTGGGATCATCCT
ATGAGTTCTAACATCATTTCGCGGAACCACGTGACGCGACTGCTTCAGAACTATAAGAAACAGCCTCGGA
ATTCTATGATTAACAAGTCATCGTTCAGTGTAGAATTTCTGCCTCTGAACTACTTCATTGAAATTCTGAC
AGATATAGAGTCCTCCAATCAAGCCCTGTATCCTTTTGAAGGACATGACAATGTGGATGCAGAATTTGTA
GAGGAAGCAGCTCTGAAACACACCGCGATGCTTTTAGGCTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222360 representing NM_017439
Red=Cloning site Green=Tags(s)

MALRLVADFDLGKDVLPWLRAQRAVSEASGAGSGGADVLENDYESLHVLNVERNGNIIYTYKDDKGNVVF
GLYDCQTRQNELLYTFEKDLQVFSCSVNSERTLLAASLVQSTKEGKRNELQPGSKCLTLLVEIHPVNNVK
VLKAVDSYIWVQFLYPHIESHPLPENHLLLISEEKYIEQFRIHVAQEDGNRVVIKNSGHLPRDRIAEDFV
WAQWDMSEQRLYYIDLKKSRSILKCIQFYADESYNLMFEVPLDISLSNSGFKLVNFGCDYHQYRDKFSKH
LTLCVFTNHTGSLCVCYSPKCASWGQITYSVFYIHKGHSKTFTTSLENVGSHMTKGITFLNLDYYVAVYL
PGHFFHLLNVQHPDLICHNLFLTGNNEMIDMLPHCPLQSLSGSLVLDCCSGKLYRALLSQSSLLQLLQNT
CLDCEKMAALHCALYCGQGAQFLEAQIIQWISENVSACHSFDLIQEFIIASSYWSVYSETSNMDKLLPHS
SVLTWNTEIPGITLVTEDIALPLMKVLSFKGYWEKLNSNLEYVKYAKPHFHYNNSVVRREWHNLISEEKT
GKRRSAAYVRNILDNAVKVISNLEARNLGPRLTPLLQEEDSHQRLLMGLMVSELKDHFLRHLQGVEKKKI
EQMVLDYISKLLDLICHIVETNLRKHNLHSWVLHFNSRGSAAEFAVFHIMTRILEATNSLFLPLPPGFHT
LHTILGVQCLPLHNLLHCIDSGVLLLTETAVIRLMKDLDNTEKNEKLKFSIIVRLPPLIGQKICRLWDHP
MSSNIISRNHVTRLLQNYKKQPRNSMINKSSFSVEFLPLNYFIEILTDIESSNQALYPFEGHDNVDAEFV
EEAALKHTAMLLGL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_017439
ORF Size 2562 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_017439.3, NP_059135
RefSeq Size 3265
RefSeq ORF 2565
Locus ID 54103
Cytogenetics 7q11.23
Protein Families Druggable Genome
MW 97.6 kDa
Gene Summary Accumulation of neurotoxic amyloid-beta is a major hallmark of Alzheimer disease (AD; MIM 104300). Formation of amyloid-beta is catalyzed by gamma-secretase (see PSEN1; MIM 104311), a protease with numerous substrates. PION, or GSAP, selectively increases amyloid-beta production through a mechanism involving its interaction with both gamma-secretase and its substrate, the amyloid-beta precursor protein (APP; MIM 104760) C-terminal fragment (APP-CTF) (He et al., 2010 [PubMed 20811458]).[supplied by OMIM, Nov 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)