PDX1 (NM_000209) Human Tagged ORF Clone

SKU
RC222354
PDX1 (Myc-DDK-tagged)-Human pancreatic and duodenal homeobox 1 (PDX1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Target Symbol PDX1
Synonyms GSF; IDX-1; IPF1; IUF1; MODY4; PAGEN1; PDX-1; STF-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222354 representing NM_000209
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGGCGAGGAGCAGTACTACGCGGCCACGCAGCTTTACAAGGACCCATGCGCGTTCCAGCGAGGCC
CGGCGCCGGAGTTCAGCGCCAGCCCCCCTGCGTGCCTGTACATGGGCCGCCAGCCCCCGCCGCCGCCGCC
GCACCCGTTCCCTGGCGCCCTGGGCGCGCTGGAGCAGGGCAGCCCCCCTGACATCTCCCCGTACGAGGTG
CCCCCCCTCGCCGACGACCCCGCGGTGGCGCACCTTCACCACCACCTCCCGGCTCAGCTCGCGCTCCCCC
ACCCGCCCGCCGGGCCCTTCCCGGAGGGAGCCGAACCGGGCGTCCTGGAGGAGCCCAACCGCGTCCAGCT
GCCTTTCCCATGGATGAAGTCTACCAAAGCTCACGCGTGGAAAGGCCAGTGGGCAGGCGGCGCCTACGCT
GCGGAGCCGGAGGAGAACAAGCGGACGCGCACGGCCTACACGCGCGCACAGCTGCTAGAGCTGGAGAAGG
AGTTCCTATTCAACAAGTACATCTCACGGCCGCGCCGGGTGGAGCTGGCTGTCATGTTGAACTTGACCGA
GAGACACATCAAGATCTGGTTCCAAAACCGCCGCATGAAGTGGAAAAAGGAGGAGGACAAGAAGCGCGGC
GGCGGGACAGCTGTCGGGGGTGGCGGGGTCGCGGAGCCTGAGCAGGACTGCGCCGTGACCTCCGGCGAGG
AGCTTCTGGCGCTGCCGCCGCCGCCGCCCCCCGGAGGTGCTGTGCCGCCCGCTGCCCCCGTTGCCGCCCG
AGAGGGCCGCCTGCCGCCTGGCCTTAGCGCGTCGCCACAGCCCTCCAGCGTCGCGCCTCGGCGGCCGCAG
GAACCACGA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222354 representing NM_000209
Red=Cloning site Green=Tags(s)

MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEV
PPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYA
AEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRG
GGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ
EPR

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_000209
ORF Size 849 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000209.4
RefSeq Size 1525 bp
RefSeq ORF 852 bp
Locus ID 3651
UniProt ID P52945
Cytogenetics 13q12.2
Protein Families Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors
Protein Pathways Maturity onset diabetes of the young, Type II diabetes mellitus
MW 30.6 kDa
Summary The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (IDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq, Aug 2017]
Write Your Own Review
You're reviewing:PDX1 (NM_000209) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222354L1 Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), Myc-DDK-tagged 10 ug
$750.00
RC222354L2 Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), mGFP tagged 10 ug
$750.00
RC222354L3 Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), Myc-DDK-tagged 10 ug
$750.00
RC222354L4 Lenti ORF clone of Human pancreatic and duodenal homeobox 1 (PDX1), mGFP tagged 10 ug
$750.00
RG222354 PDX1 (tGFP-tagged) - Human pancreatic and duodenal homeobox 1 (PDX1) 10 ug
$650.00
SC300025 PDX1 (untagged)-Human pancreatic and duodenal homeobox 1 (PDX1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.