BRDT (NM_207189) Human Tagged ORF Clone

CAT#: RC222276

Reviews ()
Write a review
  • TrueORF®

BRDT (Myc-DDK-tagged)-Human bromodomain, testis-specific (BRDT), transcript variant 1



  "NM_207189" in other vectors (6)

USD 750.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BRDT (NM_207189) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BRDT
Synonyms BRD6; CT9; SPGF21
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC222276 representing NM_207189
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCTGCCAAGTCGACAAACAGCTATTATTGTTAACCCTCCTCCACCAGAATATATAAATACTAAGA
AAAATGGGCGATTGACAAATCAACTTCAGTATCTACAAAAAGTTGTCCTAAAGGATTTATGGAAGCATAG
TTTTTCATGGCCCTTTCAACGTCCTGTGGATGCTGTGAAACTACAGTTGCCTGATTATTATACCATTATA
AAAAACCCAATGGATTTAAATACAATTAAGAAGCGCTTGGAGAATAAATATTATGCGAAGGCTTCAGAAT
GTATAGAAGACTTCAATACAATGTTCTCAAATTGTTATTTATATAACAAGCCTGGAGATGACATTGTTCT
TATGGCACAAGCTCTAGAGAAGCTGTTTATGCAGAAATTATCTCAGATGCCACAAGAAGAGCAAGTTGTG
GGTGTTAAGGAAAGAATCAAGAAAGGCACTCAACAGAATATAGCTGTTTCTTCTGCTAAAGAAAAATCAT
CACCCAGCGCAACAGAAAAAGTATTTAAGCAGCAAGAAATTCCTTCTGTATTTCCTAAGACATCTATTTC
TCCCTTGAACGTGGTACAGGGAGCTTCAGTCAACTCCAGTTCACAAACTGCGGCCCAAGTTACAAAAGGT
GTGAAGAGGAAAGCAGATACAACAACTCCTGCAACTTCAGCAGTTAAAGCAAGTAGTGAATTTTCTCCAA
CATTCACAGAAAAATCAGTGGCACTGCCACCTATAAAAGAAAATATGCCAAAGAATGTTTTGCCAGATTC
TCAGCAACAATATAATGTTGTGAAGACTGTTAAAGTAACTGAACAATTAAGGCACTGTAGTGAGATTCTT
AAAGAAATGCTTGCAAAGAAACATTTTTCATATGCATGGCCCTTTTATAATCCTGTTGACGTTAATGCTT
TGGGACTCCATAACTACTATGACGTTGTCAAAAATCCGATGGATCTTGGAACTATTAAGGAGAAAATGGA
TAACCAAGAATATAAGGATGCATACAAATTTGCGGCAGATGTTAGATTAATGTTCATGAATTGCTACAAG
TACAATCCTCCAGATCACGAAGTTGTGACAATGGCAAGAATGCTTCAGGATGTTTTCGAAACGCATTTTT
CAAAGATCCCGATTGAACCTGTTGAGAGTATGCCTTTATGTTACATCAAAACAGATATCACAGAAACCAC
TGGTAGAGAGAACACTAATGAAGCCTCCTCTGAAGGGAACTCTTCTGATGATTCTGAAGATGAGCGAGTT
AAGCGTCTTGCAAAGCTTCAGGAGCAGCTTAAAGCTGTACATCAACAGCTCCAGGTTTTGTCCCAAGTAC
CTTTCCGTAAGCTAAATAAAAAGAAAGAGAAGTCTAAAAAGGAAAAGAAAAAAGAAAAGGTTAATAACAG
CAATGAAAATCCAAGAAAAATGTGTGAGCAAATGAGGCTAAAGGAAAAGTCCAAGAGAAATCAGCCAAAG
AAAAGGAAACAACAGTTCATTGGTCTAAAATCTGAAGATGAAGATAATGCTAAACCTATGAACTATGATG
AGAAAAGGCAGTTAAGTCTGAATATAAACAAACTCCCTGGAGATAAACTTGGGCGAGTAGTTCACATAAT
ACAATCAAGAGAGCCTTCTCTGAGCAATTCCAATCCTGATGAGATAGAGATAGACTTTGAAACACTGAAA
GCATCAACACTAAGAGAATTAGAAAAATATGTTTCGGCATGTCTAAGAAAGAGACCATTAAAACCTCCTG
CTAAGAAAATAATGATGTCCAAAGAAGAACTTCACTCACAGAAAAAACAGGAATTGGAAAAGCGGTTACT
GGATGTTAATAATCAGTTAAATTCTAGAAAACGTCAAACAAAATCTGATAAAACGCAACCATCCAAAGCT
GTTGAAAATGTTTCCCGACTGAGTGAGAGCAGCAGCAGCAGCAGCAGCTCATCAGAGTCTGAAAGTAGCA
GCAGTGACTTAAGCTCTTCAGACAGCAGTGATTCTGAATCAGAAATGTTCCCTAAGTTTACAGAAGTAAA
ACCAAATGATTCTCCTTCTAAAGAGAATGTAAAGAAAATGAAGAATGAATGCATACTGCCTGAAGGAAGA
ACAGGCGTCACACAGATAGGATATTGTGTGCAAGACACAACCTCTGCCAATACTACCCTTGTTCATCAGA
CCACACCTTCACATGTAATGCCACCAAATCACCACCAATTAGCATTTAATTATCAAGAATTAGAACATTT
ACAGACTGTGAAAAACATTTCACCTTTACAAATTCTGCCTCCCTCAGGTGATTCTGAACAGCTCTCAAAT
GGCATAACTGTGATGCATCCATCTGGTGATAGTGACACAACGATGTTAGAATCTGAATGTCAAGCTCCTG
TACAGAAGGATATAAAGATTAAGAATGCAGATTCATGGAAAAGTTTAGGCAAACCAGTGAAACCATCAGG
TGTAATGAAATCCTCAGATGAGCTCTTCAACCAATTTAGAAAAGCAGCCATAGAAAAGGAAGTAAAAGCT
CGGACACAGGAACTCATACGGAAGCATTTGGAACAAAATACAAAGGAACTAAAAGCATCTCAAGAAAATC
AGAGGGATCTTGGGAATGGATTGACTGTAGAATCTTTTTCAAATAAAATACAAAACAAGTGCTCTGGAGA
AGAGCAGAAAGAACATCAGCAGTCATCAGAAGCTCAAGATAAATCCAAACTCTGGCTTCTCAAAGACCGT
GATTTAGCAAGGCAGAAAGAACAAGAGAGGAGGAGGAGAGAAGCAATGGTGGGTACCATTGATATGACCC
TTCAAAGTGACATTATGACAATGTTTGAAAACAACTTTGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222276 representing NM_207189
Red=Cloning site Green=Tags(s)

MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTII
KNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEEQVV
GVKERIKKGTQQNIAVSSAKEKSSPSATEKVFKQQEIPSVFPKTSISPLNVVQGASVNSSSQTAAQVTKG
VKRKADTTTPATSAVKASSEFSPTFTEKSVALPPIKENMPKNVLPDSQQQYNVVKTVKVTEQLRHCSEIL
KEMLAKKHFSYAWPFYNPVDVNALGLHNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFMNCYK
YNPPDHEVVTMARMLQDVFETHFSKIPIEPVESMPLCYIKTDITETTGRENTNEASSEGNSSDDSEDERV
KRLAKLQEQLKAVHQQLQVLSQVPFRKLNKKKEKSKKEKKKEKVNNSNENPRKMCEQMRLKEKSKRNQPK
KRKQQFIGLKSEDEDNAKPMNYDEKRQLSLNINKLPGDKLGRVVHIIQSREPSLSNSNPDEIEIDFETLK
ASTLRELEKYVSACLRKRPLKPPAKKIMMSKEELHSQKKQELEKRLLDVNNQLNSRKRQTKSDKTQPSKA
VENVSRLSESSSSSSSSSESESSSSDLSSSDSSDSESEMFPKFTEVKPNDSPSKENVKKMKNECILPEGR
TGVTQIGYCVQDTTSANTTLVHQTTPSHVMPPNHHQLAFNYQELEHLQTVKNISPLQILPPSGDSEQLSN
GITVMHPSGDSDTTMLESECQAPVQKDIKIKNADSWKSLGKPVKPSGVMKSSDELFNQFRKAAIEKEVKA
RTQELIRKHLEQNTKELKASQENQRDLGNGLTVESFSNKIQNKCSGEEQKEHQQSSEAQDKSKLWLLKDR
DLARQKEQERRRREAMVGTIDMTLQSDIMTMFENNFD

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_207189
ORF Size 2841 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_207189.1, NM_207189.2, NM_207189.3, NP_997072.1, NP_997072.2
RefSeq Size 3157 bp
RefSeq ORF 2844 bp
Locus ID 676
Cytogenetics 1p22.1
Protein Families Protein Kinase, Transcription Factors
MW 107.8 kDa
Gene Summary BRDT is similar to the RING3 protein family. It possesses 2 bromodomain motifs and a PEST sequence (a cluster of proline, glutamic acid, serine, and threonine residues), characteristic of proteins that undergo rapid intracellular degradation. The bromodomain is found in proteins that regulate transcription. Several transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Jun 2011]

Citations (2)

Other Versions

Other products for "BRDT"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-BRDT Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools