Aminoadipate aminotransferase(AADAT) (NM_182662) Human Tagged ORF Clone

CAT#: RC222252

AADAT (Myc-DDK-tagged)-Human aminoadipate aminotransferase (AADAT), transcript variant 2

Change vector?

USD 546


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Aminoadipate aminotransferase(AADAT) (NM_182662) Human Tagged ORF Clone
Symbol AADAT
Synonyms KAT2; KATII; KYAT2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC222252 representing NM_182662
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATTACGCACGGTTCATCACGGCAGCGAGCGCAGCCAGAAACCCTTCTCCCATCCGGACCATGACTG
ACATATTGAGCAGAGGACCAAAATCGATGATCTCCTTGGCTGGTGGCTTACCAAATCCAAACATGTTTCC
TTTTAAGACTGCCGTAATCACTGTAGAAAATGGAAAGACCATCCAATTTGGAGAAGAGATGATGAAGAGA
GCACTTCAGTATTCTCCGAGTGCTGGAATTCCAGAGCTTTTGTCCTGGCTAAAACAGTTACAAATAAAAT
TGCATAATCCTCCTACCATCCATTACCCACCCAGTCAAGGACAAATGGATCTATGTGTCACATCTGGCAG
CCAACAAGGTCTTTGTAAGGTGTTTGAAATGATCATTAATCCTGGAGATAATGTCCTCCTAGATGAACCT
GCTTATTCAGGAACTCTTCAAAGTCTGCACCCACTGGGCTGCAACATTATTAATGTTGCCAGTGATGAAA
GTGGGATTGTTCCAGATTCCCTAAGAGACATACTTTCCAGATGGAAACCAGAAGATGCAAAGAATCCCCA
GAAAAACACCCCCAAATTTCTTTATACTGTTCCAAATGGCAACAACCCTACTGGAAACTCATTAACCAGT
GAACGCAAAAAGGAAATCTATGAGCTTGCAAGAAAATATGATTTCCTCATAATAGAAGATGATCCTTACT
ATTTTCTCCAGTTTAACAAGTTCAGGGTACCAACATTTCTTTCCATGGATGTTGATGGACGTGTCATCAG
AGCTGACTCTTTTTCAAAAATCATTTCCTCTGGGTTGAGAATAGGATTTTTAACTGGTCCAAAACCCTTA
ATAGAGAGAGTTATTTTACACATACAAGTTTCAACATTGCACCCCAGCACTTTTAACCAGCTCATGATAT
CACAGCTTCTACACGAATGGGGAGAAGAAGGTTTCATGGCTCATGTAGACAGGGTTATTGATTTCTATAG
TAACCAGAAGGATGCAATACTGGCAGCTGCAGACAAGTGGTTAACTGGTTTGGCAGAATGGCATGTTCCT
GCTGCTGGAATGTTTTTATGGATTAAAGTTAAAGGCATTAATGATGTAAAAGAACTGATTGAAGAAAAGG
CCGTTAAGATGGGGGTATTAATGCTCCCTGGAAATGCTTTCTACGTCGATAGCTCAGCTCCTAGCCCTTA
CTTGAGAGCATCCTTCTCTTCAGCTTCTCCAGAACAGATGGATGTGGCCTTCCAGGTATTAGCACAACTT
ATAAAAGAATCTTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222252 representing NM_182662
Red=Cloning site Green=Tags(s)

MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKR
ALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEP
AYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTS
ERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPL
IERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVP
AAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_182662
ORF Size 1275 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_182662.1, NP_872603
RefSeq Size 2108
RefSeq ORF 1278
Locus ID 51166
Cytogenetics 4q33
Protein Pathways Lysine biosynthesis, Lysine degradation, Tryptophan metabolism, Metabolic pathways
MW 47.2 kDa
Gene Summary This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.