P2RX7 (NM_002562) Human Tagged ORF Clone

CAT#: RC222143

Reviews ()
Write a review

P2RX7 (Myc-DDK-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1



  "NM_002562" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 703.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol P2RX7
Synonyms P2X7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC222143 representing NM_002562
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGCCTGCTGCAGCTGCAGTGATGTTTTCCAGTATGAGACGAACAAAGTCACTCGGATCCAGAGCA
TGAATTATGGCACCATTAAGTGGTTCTTCCACGTGATCATCTTTTCCTACGTTTGCTTTGCTCTGGTGAG
TGACAAGCTGTACCAGCGGAAAGAGCCTGTCATCAGTTCTGTGCACACCAAGGTGAAGGGGATAGCAGAG
GTGAAAGAGGAGATCGTGGAGAATGGAGTGAAGAAGTTGGTGCACAGTGTCTTTGACACCGCAGACTACA
CCTTCCCTTTGCAGGGGAACTCTTTCTTCGTGATGACAAACTTTCTCAAAACAGAAGGCCAAGAGCAGCG
GTTGTGTCCCGAGTATCCCACCCGCAGGACGCTCTGTTCCTCTGACCGAGGTTGTAAAAAGGGATGGATG
GACCCGCAGAGCAAAGGAATTCAGACCGGAAGGTGTGTAGTGTATGAAGGGAACCAGAAGACCTGTGAAG
TCTCTGCCTGGTGCCCCATCGAGGCAGTGGAAGAGGCCCCCCGGCCTGCTCTCTTGAACAGTGCCGAAAA
CTTCACTGTGCTCATCAAGAACAATATCGACTTCCCCGGCCACAACTACACCACGAGAAACATCCTGCCA
GGTTTAAACATCACTTGTACCTTCCACAAGACTCAGAATCCACAGTGTCCCATTTTCCGACTAGGAGACA
TCTTCCGAGAAACAGGCGATAATTTTTCAGATGTGGCAATTCAGGGCGGAATAATGGGCATTGAGATCTA
CTGGGACTGCAACCTAGACCGTTGGTTCCATCACTGCCGTCCCAAATACAGTTTCCGTCGCCTTGACGAC
AAGACCACCAACGTGTCCTTGTACCCTGGCTACAACTTCAGATACGCCAAGTACTACAAGGAAAACAATG
TTGAGAAACGGACTCTGATAAAAGTCTTCGGGATCCGTTTTGACATCCTGGTTTTTGGCACCGGAGGAAA
ATTTGACATTATCCAGCTGGTTGTGTACATCGGCTCAACCCTCTCCTACTTCGGTCTGGCCGCTGTGTTC
ATCGACTTCCTCATCGACACTTACTCCAGTAACTGCTGTCGCTCCCATATTTATCCCTGGTGCAAGTGCT
GTCAGCCCTGTGTGGTCAACGAATACTACTACAGGAAGAAGTGCGAGTCCATTGTGGAGCCAAAGCCGAC
ATTAAAGTATGTGTCCTTTGTGGATGAATCCCACATTAGGATGGTGAACCAGCAGCTACTAGGGAGAAGT
CTGCAAGATGTCAAGGGCCAAGAAGTCCCAAGACCTGCGATGGACTTCACAGATTTGTCCAGGCTGCCCC
TGGCCCTCCATGACACACCCCCGATTCCTGGACAACCAGAGGAGATACAGCTGCTTAGAAAGGAGGCGAC
TCCTAGATCCAGGGATAGCCCCGTCTGGTGCCAGTGTGGAAGCTGCCTCCCATCTCAACTCCCTGAGAGC
CACAGGTGCCTGGAGGCGCTGTGCTGCCGGAAAAAGCCGGGGGCCTGCATCACCACCTCAGAGCTGTTCA
GGAAGCTGGTCCTGTCCAGACACGTCCTGCAGTTCCTCCTGCTCTACCAGGAGCCCTTGCTGGCGCTGGA
TGTGGATTCCACCAACAGCCGGCTGCGGCACTGTGCCTACAGGTGCTACGCCACCTGGCGCTTCGGCTCC
CAGGACATGGCTGACTTTGCCATCCTGCCCAGCTGCTGCCGCTGGAGGATCCGGAAAGAGTTTCCGAAGA
GTGAAGGGCAGTACAGTGGCTTCAAGAGTCCTTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222143 representing NM_002562
Red=Cloning site Green=Tags(s)

MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAE
VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWM
DPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILP
GLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDD
KTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVF
IDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRS
LQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPES
HRCLEALCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGS
QDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002562
ORF Size 1785 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002562.6
RefSeq Size 3155 bp
RefSeq ORF 1788 bp
Locus ID 5027
UniProt ID Q99572
Cytogenetics 12q24.31
Domains P2X_receptor
Protein Families Druggable Genome, Ion Channels: ATP Receptors, Transmembrane
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction
MW 68.4 kDa
Gene Summary The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple alternatively spliced variants have been identified, most of which fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq, Jul 2010]

Other Versions

Other products for "P2RX7"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.