INPP5A (NM_005539) Human Tagged ORF Clone

CAT#: RC222083

Reviews ()
Write a review

INPP5A (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase, 40kDa (INPP5A)

  View "NM_005539" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name INPP5A (NM_005539) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol INPP5A
Synonyms 5PTASE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC222083 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGGAAGGCGGCCGCCCCGGGCACCGCGGTGCTGCTGGTCACGGCCAACGTGGGCTCGCTCTTCG
ACGACCCAGAAAACCTGCAGAAGAACTGGCTTCGGGAATTTTACCAGGTCGTGCACACACACAAGCCGCA
CTTCATGGCCTTGCACTGTCAGGAGTTTGGAGGGAAGAACTACGAGGCCTCCATGTCCCACGTGGACAAG
TTCGTCAAAGAACTATTGTCGAGTGATGCGATGAAAGAATATAACAGGGCTCGAGTCTACCTGGATGAAA
ACTACAAATCCCAGGAGCACTTCACGGCACTAGGAAGCTTTTATTTTCTTCATGAGTCCTTAAAAAACAT
CTACCAGTTTGACTTTAAAGCTAAGAAGTATAGAAAGGTCGCTGGCAAAGAGATCTACTCGGATACCTTA
GAGAGCACGCCCATGCTGGAGAAGGAGAAGTTTCCGCAGGACTACTTCCCCGAGTGCAAATGGTCAAGAA
AAGGCTTCATCCGGACGAGGTGGTGCATTGCAGACTGTGCCTTTGACTTGGTGAATATCCATCTTTTCCA
TGATGCTTCCAATCTGGTCGCCTGGGAAACAAGCCCTTCCGTGTACTCGGGAATCCGGCACAAGGCACTG
GGCTACGTGCTGGACAGAATCATTGATCAGCGATTCGAGAAGGTTTCCTACTTTGTATTTGGTGATTTCA
ACTTCCGGCTGGATTCCAAGTCCGTCGTGGAGACGCTCTGCACAAAAGCCACCATGCAGACGGTCCGGGC
CGCCGACACCAATGAAGTGGTGAAGCTCATATTTCGTGAGTCGGACAACGACCGGAAGGTTATGCTCCAG
TTAGAAAAGAAACTCTTCGACTACTTCAACCAGGAGGTTTTCCGAGACAACAACGGCACCGCGCTCTTGG
AGTTTGACAAGGAGTTGTCTGTCTTTAAGGACAGACTGTATGAACTGGACATCTCGTTCCCTCCCAGCTA
CCCGTACAGTGAGGACGCCCGCCAGGGTGAGCAGTACATGAACACCCGGTGCCCAGCCTGGTGTGACCGC
ATCCTCATGTCCCCGTCTGCCAAGGAGCTGGTGCTGCGGTCGGAGAGCGAGGAGAAGGTTGTCACCTATG
ACCACATTGGGCCCAACGTCTGCATGGGAGACCACAAGCCCGTGTTCCTGGCCTTCCGAATCATGCCCGG
GGCAGGTAAACCTCATGCCCATGTGCACAAGTGTTGTGTCGTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222083 protein sequence
Red=Cloning site Green=Tags(s)

MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDK
FVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTL
ESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKAL
GYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQ
LEKKLFDYFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDR
ILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005539
ORF Size 1236 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005539.3, NM_005539.4, NP_005530.3
RefSeq Size 2938
RefSeq ORF 1239
Locus ID 3632
Cytogenetics 10q26.3
Domains IPPc, Exo_endo_phos
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
MW 47.8 kDa
Gene Summary The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "INPP5A"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-INPP5A Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones