ARL13B (NM_182896) Human Tagged ORF Clone

CAT#: RC221949

Reviews ()
Write a review

ARL13B (Myc-DDK-tagged)-Human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1



  "NM_182896" in other vectors (4)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ARL13B (NM_182896) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ARL13B
Synonyms ARL2L1; JBTS8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC221949 representing NM_182896
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTC
TTTTGATGGTGGGACTTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGA
AGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTT
GACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATAT
TTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACA
TCCTAGGATATCGGGAAAGCCTATATTGGTGTTGGCAAATAAACAAGATAAAGAAGGAGCTTTAGGAGAA
GCTGATGTCATTGAATGTCTATCTCTGGAAAAATTGGTCAATGAGCACAAGTGCCTGTGTCAGATAGAAC
CATGTTCAGCAATCTCGGGGTATGGAAAGAAAATTGACAAGTCCATTAAAAAAGGCCTTTATTGGCTGCT
ACATGTTATTGCAAGAGACTTTGATGCCTTAAATGAACGCATCCAAAAAGAGACAACAGAGCAGCGTGCT
CTTGAGGAACAAGAGAAACAAGAAAGAGCTGAACGAGTGCGAAAATTACGAGAAGAAAGAAAACAAAATG
AACAGGAGCAGGCTGAACTCGATGGAACCAGTGGTCTGGCTGAGTTGGACCCAGAACCAACGAATCCTTT
CCAGCCAATAGCATCTGTAATCATTGAGAATGAAGGAAAACTTGAAAGAGAGAAAAAAAACCAAAAAATG
GAGAAAGACAGTGATGGCTGCCACCTGAAACATAAAATGGAGCATGAGCAAATAGAGACACAAGGCCAGG
TTAATCACAATGGCCAAAAAAATAATGAATTTGGACTAGTAGAAAATTATAAGGAGGCATTAACACAGCA
GTTAAAGAATGAAGATGAGACAGACCGGCCATCATTGGAATCAGCTAATGGTAAAAAGAAAACTAAGAAA
CTAAGAATGAAAAGGAACCACCGGGTAGAACCACTTAATATAGATGACTGTGCTCCTGAGAGTCCAACGC
CACCCCCACCCCCTCCTCCTGTTGGCTGGGGAACCCCTAAAGTCACTAGACTTCCAAAACTTGAGCCTCT
TGGTGAAACACATCATAATGATTTCTATAGGAAGCCACTGCCTCCCCTGGCTGTGCCACAGCGACCTAAC
AGTGATGCTCATGATGTGATCTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221949 representing NM_182896
Red=Cloning site Green=Tags(s)

MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIF
DLGGGIRIRGIWKNYYAESYGVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVLANKQDKEGALGE
ADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDKSIKKGLYWLLHVIARDFDALNERIQKETTEQRA
LEEQEKQERAERVRKLREERKQNEQEQAELDGTSGLAELDPEPTNPFQPIASVIIENEGKLEREKKNQKM
EKDSDGCHLKHKMEHEQIETQGQVNHNGQKNNEFGLVENYKEALTQQLKNEDETDRPSLESANGKKKTKK
LRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPN
SDAHDVIS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_182896
ORF Size 1284 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_182896.1, NM_182896.2, NP_878899.1
RefSeq Size 3451 bp
RefSeq ORF 1287 bp
Locus ID 200894
Cytogenetics 3q11.1-q11.2
MW 48.5 kDa
Gene Summary This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Citations (1)

Other Versions

Other products for "ARL13B"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-ARL13B Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools