ARL13B (NM_182896) Human Tagged ORF Clone

CAT#: RC221949

ARL13B (Myc-DDK-tagged)-Human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1

Clone Modification / Custom Cloning Service

USD 546.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ARL13B (NM_182896) Human Tagged ORF Clone
Symbol ARL13B
Synonyms ARL2L1; JBTS8
Vector pCMV6-Entry
Sequence Data
>RC221949 representing NM_182896
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTC
TTTTGATGGTGGGACTTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGA
AGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTT
GACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATAT
TTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACA
TCCTAGGATATCGGGAAAGCCTATATTGGTGTTGGCAAATAAACAAGATAAAGAAGGAGCTTTAGGAGAA
GCTGATGTCATTGAATGTCTATCTCTGGAAAAATTGGTCAATGAGCACAAGTGCCTGTGTCAGATAGAAC
CATGTTCAGCAATCTCGGGGTATGGAAAGAAAATTGACAAGTCCATTAAAAAAGGCCTTTATTGGCTGCT
ACATGTTATTGCAAGAGACTTTGATGCCTTAAATGAACGCATCCAAAAAGAGACAACAGAGCAGCGTGCT
CTTGAGGAACAAGAGAAACAAGAAAGAGCTGAACGAGTGCGAAAATTACGAGAAGAAAGAAAACAAAATG
AACAGGAGCAGGCTGAACTCGATGGAACCAGTGGTCTGGCTGAGTTGGACCCAGAACCAACGAATCCTTT
CCAGCCAATAGCATCTGTAATCATTGAGAATGAAGGAAAACTTGAAAGAGAGAAAAAAAACCAAAAAATG
GAGAAAGACAGTGATGGCTGCCACCTGAAACATAAAATGGAGCATGAGCAAATAGAGACACAAGGCCAGG
TTAATCACAATGGCCAAAAAAATAATGAATTTGGACTAGTAGAAAATTATAAGGAGGCATTAACACAGCA
GTTAAAGAATGAAGATGAGACAGACCGGCCATCATTGGAATCAGCTAATGGTAAAAAGAAAACTAAGAAA
CTAAGAATGAAAAGGAACCACCGGGTAGAACCACTTAATATAGATGACTGTGCTCCTGAGAGTCCAACGC
CACCCCCACCCCCTCCTCCTGTTGGCTGGGGAACCCCTAAAGTCACTAGACTTCCAAAACTTGAGCCTCT
TGGTGAAACACATCATAATGATTTCTATAGGAAGCCACTGCCTCCCCTGGCTGTGCCACAGCGACCTAAC
AGTGATGCTCATGATGTGATCTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221949 representing NM_182896
Red=Cloning site Green=Tags(s)

MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIF
DLGGGIRIRGIWKNYYAESYGVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVLANKQDKEGALGE
ADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDKSIKKGLYWLLHVIARDFDALNERIQKETTEQRA
LEEQEKQERAERVRKLREERKQNEQEQAELDGTSGLAELDPEPTNPFQPIASVIIENEGKLEREKKNQKM
EKDSDGCHLKHKMEHEQIETQGQVNHNGQKNNEFGLVENYKEALTQQLKNEDETDRPSLESANGKKKTKK
LRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPN
SDAHDVIS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_182896
ORF Size 1284 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_182896.1, NM_182896.2, NP_878899
RefSeq Size 3451
RefSeq ORF 1287
Locus ID 200894
Cytogenetics 3q11.1-q11.2
MW 48.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)