CPLX2 (NM_001008220) Human Tagged ORF Clone

SKU
RC221947
CPLX2 (Myc-DDK-tagged)-Human complexin 2 (CPLX2), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CPLX2
Synonyms 921-L; CPX-2; CPX2; Hfb1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221947 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACTTCGTCATGAAGCAGGCCCTTGGAGGGGCCACAAAGGACATGGGGAAGATGCTGGGGGGAGAGG
AGGAGAAGGACCCCGACGCGCAGAAAAAGGAGGAGGAGCGGCAGGAGGCGCTGCGGCAGCAGGAGGAGGA
GCGTAAGGCCAAGCACGCGCGCATGGAGGCGGAGCGGGAGAAGGTCCGGCAGCAGATCCGAGATAAGTAT
GGGCTGAAGAAGAAGGAGGAGAAGGAAGCAGAGGAGAAAGCAGCCCTGGAGCAGCCCTGCGAGGGGAGCC
TGACCCGGCCCAAGAAGGCCATCCCTGCGGGCTGCGGGGACGAGGAGGAGGAGGAAGAGGAGAGCATCCT
GGACACGGTGCTCAAATACCTGCCCGGGCCGCTGCAGGACATGTTCAAGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221947 protein sequence
Red=Cloning site Green=Tags(s)

MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKY
GLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001008220
ORF Size 402 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001008220.2
RefSeq Size 4676 bp
RefSeq ORF 405 bp
Locus ID 10814
UniProt ID Q6PUV4
Cytogenetics 5q35.2
Protein Families Druggable Genome
MW 15.4 kDa
Summary Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CPLX2 (NM_001008220) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221947L3 Lenti ORF clone of Human complexin 2 (CPLX2), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC221947L4 Lenti ORF clone of Human complexin 2 (CPLX2), transcript variant 2, mGFP tagged 10 ug
$450.00
RG221947 CPLX2 (tGFP-tagged) - Human complexin 2 (CPLX2), transcript variant 2 10 ug
$489.00
SC301261 CPLX2 (untagged)-Human complexin 2 (CPLX2), transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.