Doublecortin (DCX) (NM_178152) Human Tagged ORF Clone

CAT#: RC221891

Reviews ()
Write a review

DCX (Myc-DDK-tagged)-Human doublecortin (DCX), transcript variant 2



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DCX
Synonyms DBCN; DC; LISX; SCLH; XLIS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221891 representing NM_178152
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACTTGATTTTGGACACTTTGACGAAAGAGATAAGACATCCAGGAACATGCGAGGCTCCCGGATGA
ATGGGTTGCCTAGCCCCACTCACAGCGCCCACTGTAGCTTCTACCGAACCAGAACCTTGCAGGCACTGAG
TAATGAGAAGAAAGCCAAGAAGGTACGTTTCTACCGCAATGGGGACCGCTACTTCAAGGGGATTGTGTAC
GCTGTGTCCTCTGACCGTTTTCGCAGCTTTGACGCCTTGCTGGCTGACCTGACGCGATCTCTGTCTGACA
ACATCAACCTGCCTCAGGGAGTGCGTTACATTTACACCATTGATGGATCCAGGAAGATCGGAAGCATGGA
TGAACTGGAGGAAGGGGAAAGCTATGTCTGTTCCTCAGACAACTTCTTTAAAAAGGTGGAGTACACCAAG
AATGTCAATCCCAACTGGTCTGTCAACGTAAAAACATCTGCCAATATGAAAGCCCCCCAGTCCTTGGCTA
GCAGCAACAGTGCACAGGCCAGGGAGAACAAGGACTTTGTGCGCCCCAAGCTGGTTACCATCATCCGCAG
TGGGGTGAAGCCTCGGAAGGCTGTGCGTGTGCTTCTGAACAAGAAGACAGCCCACTCTTTTGAGCAAGTC
CTCACTGATATCACAGAAGCCATCAAACTGGAGACCGGGGTTGTCAAAAAACTCTACACTCTGGATGGAA
AACAGGTAACTTGTCTCCATGATTTCTTTGGTGATGATGATGTGTTTATTGCCTGTGGTCCTGAAAAATT
TCGCTATGCTCAGGATGATTTTTCTCTGGATGAAAATGAATGCCGAGTCATGAAGGGAAACCCATCAGCC
ACAGCTGGCCCAAAGGCATCCCCAACACCTCAGAAGACTTCAGCCAAGAGCCCTGGTCCTATGCGCCGAA
GCAAGTCTCCAGCTGACTCAGGTAACGACCAAGACGCAAACGGAACCTCCAGCAGCCAGCTCTCTACCCC
CAAGTCTAAGCAGTCTCCCATCTCTACGCCCACCAGTCCTGGCAGCCTCCGGAAGCACAAGGACCTGTAC
CTGCCTCTGTCCTTGGATGACTCGGACTCGCTTGGTGATTCCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221891 representing NM_178152
Red=Cloning site Green=Tags(s)

MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVY
AVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTK
NVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQV
LTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSA
TAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLY
LPLSLDDSDSLGDSM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_178152
ORF Size 1095 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_178152.3
RefSeq Size 9069 bp
RefSeq ORF 1098 bp
Locus ID 1641
UniProt ID O43602
Cytogenetics Xq23
Protein Families Druggable Genome
MW 40.4 kDa
Gene Summary This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic protein and contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded protein appears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene cause abnormal migration of neurons during development and disrupt the layering of the cortex, leading to epilepsy, cognitive disability, subcortical band heterotopia ("double cortex" syndrome) in females and lissencephaly ("smooth brain" syndrome) in males. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.