CPEB4 (NM_030627) Human Tagged ORF Clone

CAT#: RC221803

CPEB4 (Myc-DDK-tagged)-Human cytoplasmic polyadenylation element binding protein 4 (CPEB4)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CPEB4 (NM_030627) Human Tagged ORF Clone
Symbol CPEB4
Synonyms KIAA1673
Vector pCMV6-Entry
Sequence Data
>RC221803 representing NM_030627
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGATTACGGGTTTGGAGTGCTAGTGCAAAGCAATACTGGGAATAAATCTGCTTTTCCAGTCAGAT
TCCATCCACATCTGCAGCCTCCACACCATCACCAAAATGCCACCCCCAGCCCTGCTGCTTTTATAAATAA
TAACACAGCTGCCAATGGCAGCAGTGCTGGGTCAGCTTGGCTTTTTCCTGCTCCAGCTACCCATAACATT
CAGGATGAGATCTTGGGGTCAGAAAAAGCAAAAAGTCAGCAACAGGAACAGCAAGACCCCTTAGAAAAGC
AGCAGCTTTCCCCAAGTCCAGGTCAGGAAGCTGGAATACTGCCTGAAACAGAGAAGGCAAAATCAGAAGA
AAATCAAGGGGACAATTCTTCGGAAAATGGCAATGGGAAGGAGAAAATAAGGATCGAATCTCCAGTGTTG
ACAGGGTTTGATTATCAAGAAGCCACTGGGCTAGGTACTTCAACCCAACCCTTGACATCTAGCGCATCGT
CTCTTACTGGTTTCAGTAACTGGTCAGCAGCGATAGCGCCTTCCTCCTCTACAATAATCAATGAAGATGC
AAGTTTCTTTCACCAGGGAGGGGTCCCTGCTGCTTCGGCTAATAACGGTGCTCTGTTGTTTCAAAATTTC
CCCCATCATGTCAGCCCTGGCTTTGGAGGCAGCTTCTCTCCTCAGATCGGGCCTCTCTCACAGCACCACC
CACATCACCCTCATTTCCAGCATCATCACAGCCAGCATCAGCAGCAAAGGAGGTCTCCTGCCAGTCCCCA
TCCCCCACCCTTCACACATAGAAATGCTGCTTTTAACCAGCTGCCTCATTTGGCGAATAATCTTAACAAA
CCCCCCTCTCCGTGGAGCAGCTACCAGAGTCCGTCACCAACACCCTCCTCTTCCTGGAGCCCGGGCGGTG
GTGGATATGGTGGCTGGGGAGGTTCCCAAGGCCGAGATCACCGCAGAGGGCTGAATGGTGGAATAACGCC
CCTGAACTCCATCTCGCCTTTGAAGAAAAATTTTGCAAGCAATCATATTCAGCTCCAGAAGTATGCTCGC
CCCAGCTCTGCCTTTGCACCTAAATCCTGGATGGAAGATAGCTTGAACAGGGCTGACAACATTTTTCCTT
TTCCGGATCGCCCCAGGACATTCGACATGCACTCACTGGAGAGTTCACTCATTGACATAATGAGAGCTGA
AAATGATACCATTAAAGGTCGTCTAAACTATTCATATCCAGGATCCGATAGCTCTCTGCTTATTAATGCA
AGGACATATGGGCGAAGGAGAGGTCAGTCTTCACTGTTTCCAATGGAAGATGGATTCTTGGATGATGGCC
GTGGGGATCAGCCTCTTCATAGTGGCCTGGGTTCACCTCACTGCTTCAGTCACCAGAATGGGGAAAGAGT
GGAACGATATTCTCGAAAGGTGTTTGTAGGCGGATTGCCTCCAGACATTGATGAAGATGAGATCACAGCT
AGTTTTCGTCGCTTTGGCCCTCTGATTGTGGATTGGCCTCATAAAGCTGAGAGCAAATCCTATTTTCCTC
CTAAAGGCTATGCATTCCTGCTGTTTCAAGATGAAAGCTCTGTGCAGGCTCTCATTGATGCATGCATTGA
AGAAGATGGAAAACTCTACCTTTGTGTATCAAGTCCCACTATCAAGGATAAGCCAGTCCAGATTCGGCCT
TGGAATCTCAGTGACAGTGACTTTGTGATGGATGGTTCACAGCCACTTGACCCACGAAAAACTATATTTG
TTGGTGGTGTTCCTCGACCATTACGAGCTGTGGAGCTTGCGATGATAATGGATCGGCTATATGGAGGTGT
GTGCTACGCTGGGATTGATACCGACCCTGAGCTAAAATACCCAAAAGGAGCTGGGAGAGTTGCGTTCTCT
AATCAACAGAGTTACATAGCTGCTATCAGTGCCCGCTTTGTTCAGCTGCAGCATGGAGAGATAGATAAAC
GGGTGGAAGTTAAGCCATATGTCTTGGATGATCAGCTGTGTGATGAATGTCAGGGGGCCCGTTGTGGGGG
GAAATTTGCTCCATTTTTCTGTGCTAATGTTACCTGTCTGCAGTATTACTGTGAATATTGCTGGGCTGCT
ATCCATTCTCGTGCTGGCAGGGAATTCCACAAGCCCCTGGTGAAGGAAGGCGGTGACCGCCCTCGGCATA
TTTCATTCCGCTGGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221803 representing NM_030627
Red=Cloning site Green=Tags(s)

MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSAGSAWLFPAPATHNI
QDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQGDNSSENGNGKEKIRIESPVL
TGFDYQEATGLGTSTQPLTSSASSLTGFSNWSAAIAPSSSTIINEDASFFHQGGVPAASANNGALLFQNF
PHHVSPGFGGSFSPQIGPLSQHHPHHPHFQHHHSQHQQQRRSPASPHPPPFTHRNAAFNQLPHLANNLNK
PPSPWSSYQSPSPTPSSSWSPGGGGYGGWGGSQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYAR
PSSAFAPKSWMEDSLNRADNIFPFPDRPRTFDMHSLESSLIDIMRAENDTIKGRLNYSYPGSDSSLLINA
RTYGRRRGQSSLFPMEDGFLDDGRGDQPLHSGLGSPHCFSHQNGERVERYSRKVFVGGLPPDIDEDEITA
SFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRP
WNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFS
NQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAA
IHSRAGREFHKPLVKEGGDRPRHISFRWN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_030627
ORF Size 2187 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_030627.1, NM_030627.2, NM_030627.3, NP_085130
RefSeq Size 6930
RefSeq ORF 2190
Locus ID 80315
Cytogenetics 5q35.2
MW 80 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)