EVI1 (MECOM) (NM_005241) Human Tagged ORF Clone

CAT#: RC221770

Reviews ()
Write a review

MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2



  "NM_005241" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 680.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MECOM
Synonyms AML1-EVI-1; EVI1; KMT8E; MDS1; MDS1-EVI1; PRDM3; RUSAT2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221770 representing NM_005241
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGAGCGAAGACTATCCCCATGAAACTATGGCGCCGGATATCCACGAAGAACGGCAATATCGCTGCG
AAGACTGTGACCAGCTCTTTGAATCTAAGGCTGAACTAGCAGATCACCAAAAGTTTCCATGCAGTACTCC
TCACTCAGCATTTTCAATGGTTGAAGAGGACTTTCAGCAAAAACTCGAAAGCGAGAATGATCTCCAAGAG
ATACACACGATCCAGGAGTGTAAGGAATGTGACCAAGTTTTTCCTGATTTGCAAAGCCTGGAGAAACACA
TGCTGTCACATACTGAAGAGAGGGAATACAAGTGTGATCAGTGTCCCAAGGCATTTAACTGGAAGTCCAA
TTTAATTCGCCACCAGATGTCACATGACAGTGGAAAGCACTATGAATGTGAAAACTGTGCCAAGGTTTTC
ACGGACCCTAGCAACCTTCAGCGGCACATTCGCTCTCAGCATGTCGGTGCCCGGGCCCATGCATGCCCGG
AGTGTGGCAAAACGTTTGCCACTTCGTCGGGCCTCAAACAACACAAGCACATCCACAGCAGTGTGAAGCC
CTTTATCTGTGAGGTCTGCCATAAATCCTATACTCAGTTTTCAAACCTTTGCCGTCATAAGCGCATGCAT
GCTGATTGCAGAACCCAAATCAAGTGCAAAGACTGTGGACAAATGTTCAGCACTACGTCTTCCTTAAATA
AACACAGGAGGTTTTGTGAGGGCAAGAACCATTTTGCGGCAGGTGGATTTTTTGGCCAAGGCATTTCACT
TCCTGGAACCCCAGCTATGGATAAAACGTCCATGGTTAATATGAGTCATGCCAACCCGGGCCTTGCTGAC
TATTTTGGCGCCAATAGGCATCCTGCTGGTCTTACCTTTCCAACAGCTCCTGGATTTTCTTTTAGCTTCC
CTGGTCTGTTTCCTTCCGGCTTGTACCACAGGCCTCCTTTGATACCTGCTAGTTCTCCTGTTAAAGGACT
ATCAAGTACTGAACAGACAAACAAAAGTCAAAGTCCCCTCATGACACATCCTCAGATACTGCCAGCTACA
CAGGATATTTTGAAGGCACTATCTAAACACCCATCTGTAGGGGACAATAAGCCAGTGGAGCTCCAGCCCG
AGAGGTCCTCTGAAGAGAGGCCCTTTGAGAAAATCAGTGACCAGTCAGAGAGTAGTGACCTTGATGATGT
CAGTACACCAAGTGGCAGTGACCTGGAAACAACCTCGGGCTCTGATCTGGAAAGTGACATTGAAAGTGAT
AAAGAGAAATTTAAAGAAAATGGTAAAATGTTCAAAGACAAAGTAAGCCCTCTTCAGAATCTGGCTTCAA
TAAATAATAAGAAAGAATACAGCAATCATTCCATTTTCTCACCATCTTTAGAGGAGCAGACTGCGGTGTC
AGGAGCTGTGAATGATTCTATAAAGGCTATTGCTTCTATTGCTGAAAAATACTTTGGTTCAACAGGACTG
GTGGGGCTGCAAGACAAAAAAGTTGGAGCTTTACCTTACCCTTCCATGTTTCCCCTCCCATTTTTTCCAG
CATTCTCTCAATCAATGTACCCATTTCCTGATAGAGACTTGAGATCGTTACCTTTGAAAATGGAACCCCA
ATCACCAGGTGAAGTAAAGAAACTGCAGAAGGGCAGCTCTGAGTCCCCCTTTGATCTCACCACTAAGCGA
AAGGATGAGAAGCCCTTGACTCCAGTCCCCTCCAAGCCTCCAGTGACACCTGCCACAAGCCAAGACCAGC
CCCTGGATCTAAGTATGGGCAGTAGGAGTAGAGCCAGTGGGACAAAGCTGACTGAGCCTCGAAAAAACCA
CGTGTTTGGGGGAAAAAAAGGAAGCAACGTCGAATCAAGACCTGCTTCAGATGGTTCCTTGCAGCATGCA
AGACCCACTCCTTTCTTTATGGACCCTATTTACAGAGTAGAGAAAAGAAAACTAACTGACCCACTTGAAG
CTTTAAAAGAGAAATACTTGAGGCCTTCTCCAGGATTCTTGTTTCACCCACAATTCCAACTGCCTGATCA
GAGAACTTGGATGTCAGCTATTGAAAACATGGCAGAAAAGCTAGAGAGCTTCAGTGCCCTGAAACCTGAG
GCCAGTGAGCTCTTACAGTCAGTGCCCTCTATGTTCAACTTCAGGGCGCCTCCCAATGCCCTGCCAGAGA
ACCTTCTGCGGAAGGGAAAGGAGCGCTATACCTGCAGATACTGTGGCAAGATTTTTCCAAGGTCTGCAAA
CCTAACACGGCACTTGAGAACCCACACAGGAGAGCAGCCTTACAGATGCAAATACTGTGACAGATCATTT
AGCATATCTTCTAACTTGCAAAGGCATGTTCGCAACATCCACAATAAAGAGAAGCCATTTAAGTGTCACT
TATGTGATAGGTGTTTTGGTCAACAAACCAATTTAGACAGACACCTAAAGAAACATGAGAATGGGAACAT
GTCCGGTACAGCAACATCGTCGCCTCATTCTGAACTGGAAAGTACAGGTGCGATTCTGGATGACAAAGAA
GATGCTTACTTCACAGAAATTCGAAATTTCATTGGGAACAGCAACCATGGCAGCCAATCTCCCAGGAATG
TGGAGGAGAGAATGAATGGCAGTCATTTTAAAGATGAAAAGGCTTTGGTGACCAGTCAAAATTCAGACTT
GCTGGATGATGAAGAAGTTGAAGATGAGGTGTTGTTAGATGAGGAGGATGAAGACAATGATATTACTGGA
AAAACAGGAAAGGAACCAGTGACAAGTAATTTACATGAAGGAAACCCTGAGGATGACTATGAAGAAACCA
GTGCCCTGGAGATGAGTTGCAAGACATCCCCAGTGAGGTATAAAGAGGAAGAATATAAAAGTGGACTTTC
TGCTCTAGATCATATAAGGCACTTCACAGATAGCCTCAAAATGAGGAAAATGGAAGATAATCAATATTCT
GAAGCTGAGCTGTCTTCTTTTAGTACTTCCCATGTGCCAGAGGAACTTAAGCAGCCGTTACACAGAAAGT
CCAAATCGCAGGCATATGCTATGATGCTGTCACTGTCTGACAAGGAGTCCCTCCATTCTACATCCCACAG
TTCTTCCAACGTGTGGCACAGTATGGCCAGGGCTGCGGCGGAATCCAGTGCTATCCAGTCCATAAGCCAC
GTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221770 representing NM_005241
Red=Cloning site Green=Tags(s)

MKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQKLESENDLQE
IHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVF
TDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH
ADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLAD
YFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPAT
QDILKALSKHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESD
KEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTGL
VGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPGEVKKLQKGSSESPFDLTTKR
KDEKPLTPVPSKPPVTPATSQDQPLDLSMGSRSRASGTKLTEPRKNHVFGGKKGSNVESRPASDGSLQHA
RPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPE
ASELLQSVPSMFNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSF
SISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKE
DAYFTEIRNFIGNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLLDEEDEDNDITG
KTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSGLSALDHIRHFTDSLKMRKMEDNQYS
EAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISH
V

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005241
ORF Size 3153 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005241.3
RefSeq Size 3570 bp
RefSeq ORF 3156 bp
Locus ID 2122
UniProt ID Q13465
Cytogenetics 3q26.2
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Chronic myeloid leukemia, MAPK signaling pathway, Pathways in cancer
MW 118.1 kDa
Gene Summary The protein encoded by this gene is a transcriptional regulator and oncoprotein that may be involved in hematopoiesis, apoptosis, development, and cell differentiation and proliferation. The encoded protein can interact with CTBP1, SMAD3, CREBBP, KAT2B, MAPK8, and MAPK9. This gene can undergo translocation with the AML1 gene, resulting in overexpression of this gene and the onset of leukemia. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]

Other Versions

Other products for "MECOM"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


MECOM rabbit polyclonal antibody
    • 25 ul

USD 800.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.