CD11b (ITGAM) (NM_000632) Human Tagged ORF Clone

CAT#: RC221743

Reviews ()
Write a review

ITGAM (Myc-DDK-tagged)-Human integrin, alpha M (complement component 3 receptor 3 subunit) (ITGAM), transcript variant 2



  "NM_000632" in other vectors (6)

Reconstitution Protocol

USD 1,003.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "ITGAM"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ITGAM
Synonyms CD11B; CR3A; MAC-1; MAC1A; MO1A; SLEB6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221743 representing NM_000632
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTCAGAGTCCTTCTGTTAACAGCCTTGACCTTATGTCATGGGTTCAACTTGGACACTGAAAACG
CAATGACCTTCCAAGAGAACGCAAGGGGCTTCGGGCAGAGCGTGGTCCAGCTTCAGGGATCCAGGGTGGT
GGTTGGAGCCCCCCAGGAGATAGTGGCTGCCAACCAAAGGGGCAGCCTCTACCAGTGCGACTACAGCACA
GGCTCATGCGAGCCCATCCGCCTGCAGGTCCCCGTGGAGGCCGTGAACATGTCCCTGGGCCTGTCCCTGG
CAGCCACCACCAGCCCCCCTCAGCTGCTGGCCTGTGGTCCCACCGTGCACCAGACTTGCAGTGAGAACAC
GTATGTGAAAGGGCTCTGCTTCCTGTTTGGATCCAACCTACGGCAGCAGCCCCAGAAGTTCCCAGAGGCC
CTCCGAGGGTGTCCTCAAGAGGATAGTGACATTGCCTTCTTGATTGATGGCTCTGGTAGCATCATCCCAC
ATGACTTTCGGCGGATGAAGGAGTTTGTCTCAACTGTGATGGAGCAATTAAAAAAGTCCAAAACCTTGTT
CTCTTTGATGCAGTACTCTGAAGAATTCCGGATTCACTTTACCTTCAAAGAGTTCCAGAACAACCCTAAC
CCAAGATCACTGGTGAAGCCAATAACGCAGCTGCTTGGGCGGACACACACGGCCACGGGCATCCGCAAAG
TGGTACGAGAGCTGTTTAACATCACCAACGGAGCCCGAAAGAATGCCTTTAAGATCCTAGTTGTCATCAC
GGATGGAGAAAAGTTTGGCGATCCCTTGGGATATGAGGATGTCATCCCTGAGGCAGACAGAGAGGGAGTC
ATTCGCTACGTCATTGGGGTGGGAGATGCCTTCCGCAGTGAGAAATCCCGCCAAGAGCTTAATACCATCG
CATCCAAGCCGCCTCGTGATCACGTGTTCCAGGTGAATAACTTTGAGGCTCTGAAGACCATTCAGAACCA
GCTTCGGGAGAAGATCTTTGCGATCGAGGGTACTCAGACAGGAAGTAGCAGCTCCTTTGAGCATGAGATG
TCTCAGGAAGGCTTCAGCGCTGCCATCACCTCTAATGGCCCCTTGCTGAGCACTGTGGGGAGCTATGACT
GGGCTGGTGGAGTCTTTCTATATACATCAAAGGAGAAAAGCACCTTCATCAACATGACCAGAGTGGATTC
AGACATGAATGATGCTTACTTGGGTTATGCTGCCGCCATCATCTTACGGAACCGGGTGCAAAGCCTGGTT
CTGGGGGCACCTCGATATCAGCACATCGGCCTGGTAGCGATGTTCAGGCAGAACACTGGCATGTGGGAGT
CCAACGCTAATGTCAAGGGCACCCAGATCGGCGCCTACTTCGGGGCCTCCCTCTGCTCCGTGGACGTGGA
CAGCAACGGCAGCACCGACCTGGTCCTCATCGGGGCCCCCCATTACTACGAGCAGACCCGAGGGGGCCAG
GTGTCCGTGTGCCCCTTGCCCAGGGGGAGGGCTCGGTGGCAGTGTGATGCTGTTCTCTACGGGGAGCAGG
GCCAACCCTGGGGCCGCTTTGGGGCAGCCCTAACAGTGCTGGGGGACGTAAATGGGGACAAGCTGACGGA
CGTGGCCATTGGGGCCCCAGGAGAGGAGGACAACCGGGGTGCTGTTTACCTGTTTCACGGAACCTCAGGA
TCTGGCATCAGCCCCTCCCATAGCCAGCGGATAGCAGGCTCCAAGCTCTCTCCCAGGCTCCAGTATTTTG
GTCAGTCACTGAGTGGGGGCCAGGACCTCACAATGGATGGACTGGTAGACCTGACTGTAGGAGCCCAGGG
GCACGTGCTGCTGCTCAGGTCCCAGCCAGTACTGAGAGTCAAGGCAATCATGGAGTTCAATCCCAGGGAA
GTGGCAAGGAATGTATTTGAGTGTAATGATCAGGTGGTGAAAGGCAAGGAAGCCGGAGAGGTCAGAGTCT
GCCTCCATGTCCAGAAGAGCACACGGGATCGGCTAAGAGAAGGACAGATCCAGAGTGTTGTGACTTATGA
CCTGGCTCTGGACTCCGGCCGCCCACATTCCCGCGCCGTCTTCAATGAGACAAAGAACAGCACACGCAGA
CAGACACAGGTCTTGGGGCTGACCCAGACTTGTGAGACCCTGAAACTACAGTTGCCGAATTGCATCGAGG
ACCCAGTGAGCCCCATTGTGCTGCGCCTGAACTTCTCTCTGGTGGGAACGCCATTGTCTGCTTTCGGGAA
CCTCCGGCCAGTGCTGGCGGAGGATGCTCAGAGACTCTTCACAGCCTTGTTTCCCTTTGAGAAGAATTGT
GGCAATGACAACATCTGCCAGGATGACCTCAGCATCACCTTCAGTTTCATGAGCCTGGACTGCCTCGTGG
TGGGTGGGCCCCGGGAGTTCAACGTGACAGTGACTGTGAGAAATGATGGTGAGGACTCCTACAGGACACA
GGTCACCTTCTTCTTCCCGCTTGACCTGTCCTACCGGAAGGTGTCCACGCTCCAGAACCAGCGCTCACAG
CGATCCTGGCGCCTGGCCTGTGAGTCTGCCTCCTCCACCGAAGTGTCTGGGGCCTTGAAGAGCACCAGCT
GCAGCATAAACCACCCCATCTTCCCGGAAAACTCAGAGGTCACCTTTAATATCACGTTTGATGTAGACTC
TAAGGCTTCCCTTGGAAACAAACTGCTCCTCAAGGCCAATGTGACCAGTGAGAACAACATGCCCAGAACC
AACAAAACCGAATTCCAACTGGAGCTGCCGGTGAAATATGCTGTCTACATGGTGGTCACCAGCCATGGGG
TCTCCACTAAATATCTCAACTTCACGGCCTCAGAGAATACCAGTCGGGTCATGCAGCATCAATATCAGGT
CAGCAACCTGGGGCAGAGGAGCCTCCCCATCAGCCTGGTGTTCTTGGTGCCCGTCCGGCTGAACCAGACT
GTCATATGGGACCGCCCCCAGGTCACCTTCTCCGAGAACCTCTCGAGTACGTGCCACACCAAGGAGCGCT
TGCCCTCTCACTCCGACTTTCTGGCTGAGCTTCGGAAGGCCCCCGTGGTGAACTGCTCCATCGCTGTCTG
CCAGAGAATCCAGTGTGACATCCCGTTCTTTGGCATCCAGGAAGAATTCAATGCTACCCTCAAAGGCAAC
CTCTCGTTTGACTGGTACATCAAGACCTCGCATAACCACCTCCTGATCGTGAGCACAGCTGAGATCTTGT
TTAACGATTCCGTGTTCACCCTGCTGCCGGGACAGGGGGCGTTTGTGAGGTCCCAGACGGAGACCAAAGT
GGAGCCGTTCGAGGTCCCCAACCCCCTGCCGCTCATCGTGGGCAGCTCTGTCGGGGGACTGCTGCTCCTG
GCCCTCATCACCGCCGCGCTGTACAAGCTCGGCTTCTTCAAGCGGCAATACAAGGACATGATGAGTGAAG
GGGGTCCCCCGGGGGCCGAACCCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221743 representing NM_000632
Red=Cloning site Green=Tags(s)

MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYST
GSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEA
LRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPN
PRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGV
IRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEM
SQEGFSAAITSNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAPHYYEQTRGGQ
VSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAIGAPGEEDNRGAVYLFHGTSG
SGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVDLTVGAQGHVLLLRSQPVLRVKAIMEFNPRE
VARNVFECNDQVVKGKEAGEVRVCLHVQKSTRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRR
QTQVLGLTQTCETLKLQLPNCIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNC
GNDNICQDDLSITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ
RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKANVTSENNMPRT
NKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLVPVRLNQT
VIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVVNCSIAVCQRIQCDIPFFGIQEEFNATLKGN
LSFDWYIKTSHNHLLIVSTAEILFNDSVFTLLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLL
ALITAALYKLGFFKRQYKDMMSEGGPPGAEPQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000632
ORF Size 3456 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000632.4
RefSeq Size 4740 bp
RefSeq ORF 3459 bp
Locus ID 3684
UniProt ID P11215
Cytogenetics 16p11.2
Domains FG-GAP, VWA
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Hematopoietic cell lineage, Leukocyte transendothelial migration, Regulation of actin cytoskeleton
MW 127.18 kDa
Gene Summary This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.