OVGP1 (NM_002557) Human Tagged ORF Clone

CAT#: RC221684

Reviews ()
Write a review

OVGP1 (Myc-DDK-tagged)-Human oviductal glycoprotein 1, 120kDa (OVGP1)



  "NM_002557" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol OVGP1
Synonyms CHIT5; EGP; MUC9; OGP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221684 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGAAGCTGTTGCTGTGGGTTGGGCTGGTTCTTGTGCTGAAACACCACGATGGTGCTGCCCATAAAC
TCGTGTGTTATTTCACCAACTGGGCACACAGTCGGCCAGGCCCTGCCTCGATCTTGCCCCATGACCTGGA
CCCCTTTCTCTGCACCCACCTGATATTTGCCTTTGCCTCAATGAACAACAATCAGATTGTTGCTAAGGAT
CTCCAGGATGAGAAAATTCTCTACCCAGAGTTCAACAAACTAAAGGAGAGGAACAGAGAGCTGAAAACAC
TACTGTCCATCGGCGGGTGGAACTTTGGCACCTCAAGATTCACCACTATGTTGTCCACATTTGCCAACCG
TGAAAAGTTTATTGCTTCAGTTATATCCCTTCTGAGGACACATGACTTTGATGGTCTTGACCTTTTCTTC
TTATATCCTGGACTAAGAGGCAGCCCCATGCATGACCGGTGGACTTTTCTCTTCTTAATTGAAGAGCTCC
TGTTTGCCTTCCGGAAGGAGGCACTGCTCACCATGCGCCCGAGGCTGCTGCTGTCTGCTGCTGTTTCTGG
GGTCCCACACATCGTCCAAACATCCTATGATGTGCGCTTTCTAGGAAGACTCCTGGATTTCATCAATGTC
TTGTCTTATGACTTACATGGAAGTTGGGAAAGGTTCACAGGACATAATAGCCCCCTCTTCTCTCTGCCTG
AAGACCCCAAATCTTCGGCATATGCTATGAATTATTGGAGAAAGCTTGGGGCACCCTCAGAGAAGCTCAT
CATGGGGATCCCCACCTATGGACGTACCTTTCGCCTCCTCAAAGCCTCTAAGAATGGGTTGCAGGCCAGA
GCGATCGGACCAGCATCTCCAGGGAAGTACACCAAGCAAGAAGGCTTCTTGGCTTATTTTGAGATTTGTT
CCTTTGTCTGGGGAGCGAAGAAGCACTGGATTGATTACCAGTATGTCCCGTATGCCAACAAGGGGAAAGA
GTGGGTTGGCTATGACAATGCCATCAGCTTCAGTTACAAGGCATGGTTTATAAGGCGAGAGCATTTTGGG
GGGGCCATGGTGTGGACATTGGACATGGATGACGTCAGGGGCACGTTCTGTGGCACTGGCCCTTTCCCCC
TTGTCTACGTATTGAATGATATCCTGGTGCGGGCTGAGTTCAGTTCAACTTCTTTACCACAATTTTGGCT
GTCATCTGCTGTGAATTCTTCAAGCACTGACCCTGAAAGGCTGGCTGTGACCACGGCATGGACCACTGAT
AGTAAGATTTTGCCCCCAGGAGGAGAGGCTGGGGTCACTGAGATCCACGGAAAGTGTGAAAATATGACTA
TAACCCCTAGAGGTACAACTGTGACCCCTACAAAGGAAACTGTATCCCTTGGAAAGCACACTGTAGCTCT
AGGAGAGAAGACTGAGATCACTGGGGCAATGACCATGACTTCTGTGGGTCATCAGTCCATGACCCCTGGA
GAGAAGGCCCTGACCCCTGTGGGTCATCAATCTGTGACCACTGGACAGAAGACCCTGACCTCTGTGGGTT
ATCAGTCTGTGACCCCTGGGGAAAAGACCCTGACCCCTGTGGGTCATCAGTCTGTGACCCCTGTGAGTCA
TCAGTCTGTGAGCCCTGGAGGAACGACTATGACCCCTGTCCATTTTCAGACTGAGACCCTTAGACAGAAT
ACAGTGGCCCCTAGAAGGAAGGCTGTGGCCCGTGAAAAGGTGACTGTCCCCTCCAGAAACATATCAGTCA
CCCCTGAAGGGCAGACTATGCCTTTAAGAGGGGAGAATTTGACTTCTGAGGTGGGCACTCACCCCAGGAT
GGGTAACTTGGGTCTTCAGATGGAAGCTGAAAACAGGATGATGCTGTCCTCCAGCCCCGTCATCCAGCTC
CCGGAACAAACTCCTCTAGCTTTTGACAACCGCTTTGTTCCCATCTATGGAAACCATTCCTCTGTCAACT
CAGTAACCCCTCAAACAAGTCCTCTTTCTCTAAAAAAAGAAATCCCAGAAAACTCTGCTGTGGATGAAGA
AGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221684 protein sequence
Red=Cloning site Green=Tags(s)

MWKLLLWVGLVLVLKHHDGAAHKLVCYFTNWAHSRPGPASILPHDLDPFLCTHLIFAFASMNNNQIVAKD
LQDEKILYPEFNKLKERNRELKTLLSIGGWNFGTSRFTTMLSTFANREKFIASVISLLRTHDFDGLDLFF
LYPGLRGSPMHDRWTFLFLIEELLFAFRKEALLTMRPRLLLSAAVSGVPHIVQTSYDVRFLGRLLDFINV
LSYDLHGSWERFTGHNSPLFSLPEDPKSSAYAMNYWRKLGAPSEKLIMGIPTYGRTFRLLKASKNGLQAR
AIGPASPGKYTKQEGFLAYFEICSFVWGAKKHWIDYQYVPYANKGKEWVGYDNAISFSYKAWFIRREHFG
GAMVWTLDMDDVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPERLAVTTAWTTD
SKILPPGGEAGVTEIHGKCENMTITPRGTTVTPTKETVSLGKHTVALGEKTEITGAMTMTSVGHQSMTPG
EKALTPVGHQSVTTGQKTLTSVGYQSVTPGEKTLTPVGHQSVTPVSHQSVSPGGTTMTPVHFQTETLRQN
TVAPRRKAVAREKVTVPSRNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQL
PEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002557
ORF Size 2034 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002557.4
RefSeq Size 2258 bp
RefSeq ORF 2037 bp
Locus ID 5016
UniProt ID Q12889
Cytogenetics 1p13.2
Protein Families Secreted Protein
MW 75.4 kDa
Gene Summary This gene encodes a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. The gene is similar to members of the mucin and the glycosyl hydrolase 18 gene families. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "OVGP1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal OVGP1 Antibody
    • 100 ug

USD 484.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.