LAF4 (AFF3) (NM_002285) Human Tagged ORF Clone

CAT#: RC221621

Reviews ()
Write a review
  • TrueORF®

AFF3 (Myc-DDK-tagged)-Human AF4/FMR2 family, member 3 (AFF3), transcript variant 1



  "NM_002285" in other vectors (4)

USD 1,290.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name LAF4 (AFF3) (NM_002285) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol AFF3
Synonyms LAF4; MLLT2-like
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC221621 representing NM_002285
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAGCTTCGACTTAGCCCTGCTCCAGGAATGGGACCTCGAGTCACTGTGTGTCTATGAACCAGATA
GAAATGCATTACGGAGGAAAGAACGAGAAAGAAGAAATCAAGAAACTCAACAGGATGATGGCACGTTTAA
TTCTAGTTACTCTCTCTTCAGTGAGCCCTACAAGACTAACAAGGGGGATGAACTCTCCAACCGGATCCAG
AACACTTTAGGCAATTATGATGAAATGAAAGACTTTTTAACTGATAGATCCAATCAGAGTCATCTCGTTG
GAGTTCCCAAACCTGGGGTTCCTCAGACTCCTGTGAACAAGATCGATGAACATTTTGTTGCAGATTCAAG
AGCCCAGAACCAGCCCTCGTCTATCTGTAGCACTACAACTTCCACACCAGCAGCTGTCCCCGTGCAGCAG
AGTAAGAGAGGCACTATGGGCTGGCAGAAGGCTGGGCACCCACCCTCTGACGGCCAACAGAGAGCAACAC
AACAGGGCTCTCTCAGGACCTTGCTTGGAGATGGTGTTGGCAGACAGCAGCCTCGGGCCAAACAAGTGTG
CAATGTGGAGGTGGGCCTTCAGACCCAGGAGAGGCCACCTGCCATGGCGGCCAAGCACAGCAGCAGCGGA
CACTGTGTTCAGAACTTTCCTCCATCCCTAGCTTCAAAACCCAGCCTGGTCCAGCAGAAACCGACCGCGT
ATGTGAGGCCAATGGACGGCCAAGATCAGGCCCCTGATGAGTCTCCTAAGCTGAAGTCGTCTTCGGAAAC
CAGCGTGCACTGCACATCATACAGGGGAGTCCCTGCCAGCAAGCCGGAGCCTGCCAGAGCCAAGGCCAAG
CTCTCCAAGTTCAGCATCCCCAAGCAGGGGGAGGAGAGTAGATCTGGAGAAACCAACAGCTGTGTTGAAG
AAATAATCCGGGAGATGACCTGGCTTCCACCACTTTCTGCTATTCAAGCACCTGGCAAAGTGGAACCAAC
CAAATTTCCATTTCCAAATAAGGACTCTCAGCTTGTATCCTCTGGACACAATAATCCAAAGAAAGGTGAT
GCAGAGCCAGAGAGTCCAGACAATGGCACATCGAATACATCAATGCTGGAAGATGACCTTAAGCTAAGCA
GTGATGAAGAGGAGAATGAACAGCAGGCAGCTCAGAGAACGGCTCTCCGCGCTCTCTCTGACAGCGCCGT
GGTCCAGCAGCCCAACTGCAGAACCTCGGTGCCTTCCAGCAAGGGCAGCAGCAGCAGCAGCAGCAGCGGC
AGCAGCAGCTCCTCCAGCGACTCAGAGAGCAGCTCCGGATCTGACTCGGAGACCGAGAGCAGCTCCAGCG
AGAGTGAGGGCAGCAAGCCCCCCCACTTCTCCAGCCCCGAGGCTGAACCGGCATCCTCTAACAAGTGGCA
GCTGGATAAATGGCTAAACAAAGTTAATCCCCACAAGCCTCCTATTCTGATCCAAAATGAAAGCCACGGG
TCAGAGAGCAATCAGTACTACAACCCGGTGAAAGAGGACGTCCAGGACTGTGGGAAAGTCCCCGACGTTT
GCCAGCCCAGCCTGAGAGAGAAGGAGATCAAGAGCACTTGCAAGGAGGAGCAAAGGCCAAGGACAGCCAA
CAAGGCCCCTGGGAGTAAAGGCGTGAAGCAGAAGTCCCCGCCCGCGGCCGTGGCCGTGGCGGTGAGCGCA
GCCGCCCCGCCACCCGCAGTGCCCTGTGCGCCCGCGGAGAACGCGCCCGCGCCTGCCCGGAGGTCCGCGG
GCAAGAAGCCCACCAGGCGCACCGAGAGGACCTCAGCCGGGGACGGCGCCAACTGCCACCGGCCCGAGGA
GCCCGCGGCCGCGGACGCGCTGGGGACGAGCGTGGTGGTCCCCCCGGAGCCCACCAAAACCAGGCCCTGT
GGCAACAACAGAGCGAGCCACCGCAAGGAGCTGCGCTCCTCCGTGACCTGCGAGAAGCGCCGCACGCGGG
GGCTAAGCAGGATCGTCCCCAAATCCAAGGAGTTCATTGAGACAGAGTCGTCATCTTCATCCTCCTCCTC
GGACTCCGACCTGGAGTCCGAGCAGGAGGAGTACCCTCTGTCCAAAGCACAGACCGTGGCTGCCTCTGCC
TCCTCCGGGAATGATCAGAGGCTGAAGGAGGCCGCTGCCAACGGGGGCAGTGGTCCTAGGGCCCCTGTAG
GCTCCATCAACGCCAGGACCACCAGTGACATCGCCAAGGAGCTGGAGGAGCAGTTCTACACACTGGTCCC
CTTTGGCCGGAACGAACTTCTCTCCCCTCTAAAGGACAGTGATGAGATCAGGTCTCTCTGGGTCAAAATC
GACCTGACCCTCCTGTCCAGGATCCCAGAACACCTGCCCCAGGAGCCAGGGGTATTGAGCGCCCCTGCCA
CCAAGGACTCTGAGAGCGCACCGCCCAGCCACACCTCGGACACACCTGCAGAAAAGGCTTTGCCAAAATC
CAAGAGGAAACGCAAGTGTGACAACGAAGACGACTACAGGGAGATCAAGAAGTCCCAGGGAGAGAAAGAC
AGCTCTTCAAGACTGGCCACCTCCACCAGTAATACTTTGTCTGCAAACCACTGCAACATGAACATCAACA
GTGTGGCAATACCAATAAATAAAAATGAAAAAATGCTTCGGTCGCCCATCTCACCCCTCTCTGATGCATC
TAAACACAAATACACCAGCGAGGACTTAACTTCTTCCAGCCGACCTAATGGCAACAGTTTGTTTACTTCA
GCCTCTTCCAGCAAAAAGCCTAAGGCCGACAGCCAGCTGCAGCCTCACGGCGGAGACCTCACGAAAGCAG
CTCACAACAATTCTGAAAACATTCCCCTCCACAAGTCACGGCCGCAGACGAAGCCGTGGTCTCCAGGCTC
CAACGGCCACAGGGACTGCAAGAGGCAGAAACTTGTCTTCGATGATATGCCTCGCAGTGCCGATTATTTT
ATGCAAGAAGCTAAACGAATGAAGCATAAAGCAGATGCAATGGTGGAAAAGTTTGGAAAGGCTTTGAACT
ATGCTGAAGCAGCATTGTCGTTTATCGAGTGTGGAAATGCAATGGAACAAGGCCCCATGGAATCCAAATC
TCCTTATACGATGTATTCAGAAACAGTAGAGCTCATCAGGTATGCTATGAGACTAAAAACCCACTCAGGC
CCCAATGCCACACCAGAAGACAAACAACTGGCTGCATTATGTTACCGATGCCTGGCCCTCCTGTACTGGC
GGATGTTTCGACTCAAAAGGGACCACGCTGTAAAGTATTCAAAAGCACTAATCGACTATTTCAAGAACTC
ATCTAAAGCCGCCCAAGCCCCATCTCCGTGGGGGGCCAGTGGAAAGAGCACTGGAACCCCATCCCCCATG
TCTCCCAACCCCTCTCCCGCCAGCTCCGTGGGGTCTCAGGGCAGCCTCTCCAACGCCAGCGCCCTGTCCC
CGTCGACCATCGTCAGCATCCCACAGCGCATCCACCAGATGGCGGCCAACCACGTCAGCATCACCAACAG
CATCCTGCACAGCTACGACTACTGGGAGATGGCCGACAACCTGGCCAAGGAAAACCGAGAATTCTTCAAC
GACCTGGATCTGCTCATGGGGCCGGTCACCCTGCACAGCAGCATGGAGCACCTGGTCCAGTACTCCCAAC
AGGGCCTGCACTGGCTGCGGAACAGCGCCCACCTGTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221621 representing NM_002285
Red=Cloning site Green=Tags(s)

MDSFDLALLQEWDLESLCVYEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQ
NTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFVADSRAQNQPSSICSTTTSTPAAVPVQQ
SKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSSSG
HCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSSETSVHCTSYRGVPASKPEPARAKAK
LSKFSIPKQGEESRSGETNSCVEEIIREMTWLPPLSAIQAPGKVEPTKFPFPNKDSQLVSSGHNNPKKGD
AEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALRALSDSAVVQQPNCRTSVPSSKGSSSSSSSG
SSSSSSDSESSSGSDSETESSSSESEGSKPPHFSSPEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHG
SESNQYYNPVKEDVQDCGKVPDVCQPSLREKEIKSTCKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVSA
AAPPPAVPCAPAENAPAPARRSAGKKPTRRTERTSAGDGANCHRPEEPAAADALGTSVVVPPEPTKTRPC
GNNRASHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQTVAASA
SSGNDQRLKEAAANGGSGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEIRSLWVKI
DLTLLSRIPEHLPQEPGVLSAPATKDSESAPPSHTSDTPAEKALPKSKRKRKCDNEDDYREIKKSQGEKD
SSSRLATSTSNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSSRPNGNSLFTS
ASSSKKPKADSQLQPHGGDLTKAAHNNSENIPLHKSRPQTKPWSPGSNGHRDCKRQKLVFDDMPRSADYF
MQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSG
PNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPM
SPNPSPASSVGSQGSLSNASALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFN
DLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAHLS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002285
ORF Size 3678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002285.1, NM_002285.2, NP_002276.2
RefSeq Size 8153 bp
RefSeq ORF 3681 bp
Locus ID 3899
Cytogenetics 2q11.2
Domains AF-4
Protein Families Transcription Factors
MW 133.3 kDa
Gene Summary This gene encodes a tissue-restricted nuclear transcriptional activator that is preferentially expressed in lymphoid tissue. Isolation of this protein initially defined a highly conserved LAF4/MLLT2 gene family of nuclear transcription factors that may function in lymphoid development and oncogenesis. In some ALL patients, this gene has been found fused to the gene for MLL. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq, Jul 2008]

Citations (2)

Other Versions

Other products for "AFF3"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-AFF3 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools