KCTD20 (NM_173562) Human Tagged ORF Clone

CAT#: RC221607

Reviews ()
Write a review

KCTD20 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 20 (KCTD20)



  "NM_173562" in other vectors (6)

USD 433.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name KCTD20 (NM_173562) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCTD20
Synonyms C6orf69; dJ108K11.3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC221607 representing NM_173562
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGTTCACCGTGGCAGTGACAGTGACAGGTTATTGCGGCAGGAGGCCAGCTGCTTAGTGGATGATA
CTTTAGCTGTAGCCCAAGAAAAAGAAGCAAACAGCCTGGCTTCATCTGGTCCTCATAATCTTACTTATCC
TCTAGGTCCCAGGAATGAAGACCTCTCACTTGACTATGCCTCTCAGCCAGCAAATCTTCAGTTCCCTCAC
ATAATGCCCCTTGCTGAAGACATCAAAGGTTCTTGCTTCCAAAGTGGGAATAAACGGAACCATGAACCTT
TTATTGCTCCAGAAAGATTTGGAAACAGTAGTGTGGGCTTTGGCAGTAATTCCCATTCCCAAGCACCAGA
GAAAGTGACGCTTCTTGTAGATGGCACACGTTTTGTTGTGAATCCACAGATTTTCACTGCTCATCCGGAT
ACCATGCTGGGAAGGATGTTTGGACCAGGAAGAGAGTACAACTTCACTCGGCCCAATGAGAAGGGAGAGT
ATGAGATTGCTGAAGGCATCAGTGCAACTGTATTTCGCACAGTGCTGGATTATTACAAAACCGGTATCAT
CAATTGTCCTGATGGCATCTCTATCCCAGATCTTAGAGATACTTGTGATTATCTCTGCATTAATTTTGAC
TTCAACACTATCCGATGTCAAGATCTGAGTGCTTTACTCCATGAACTGTCTAATGACGGTGCTCATAAGC
AGTTTGATCACTACCTCGAAGAGCTCATCTTGCCCATCATGGTGGGCTGTGCCAAGAAAGGAGAACGAGA
GTGCCACATTGTTGTGCTGACGGATGAGGATTCTGTGGACTGGGATGAAGACCACCCTCCACCAATGGGG
GAGGAATATTCCCAAATTCTTTATAGCTCCAAGCTCTACAGATTCTTCAAATATATTGAGAATAGGGATG
TTGCAAAAACAGTGTTAAAGGAACGGGGCCTAAAAAACATTCGCATTGGAATTGAAGGTTACCCTACCTG
TAAAGAAAAAATTAAGAGAAGGCCTGGCGGCCGGTCTGAAGTCATCTATAATTATGTACAACGCCCCTTC
ATCCAGATGTCATGGGAAAAGGAAGAAGGGAAGAGTCGCCATGTGGATTTCCAGTGTGTTCGAAGCAAAT
CCCTCACGAATCTGGTAGCTGCTGGAGATGATGTCTTGGAGGACCAGGAGATATTAATGCATCACCCACC
CCAAGTGGATGAACTTGACCGGCTAAATGCCCCACTTTCTCAGATGGCTTCTAACGACTTTCAGGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221607 representing NM_173562
Red=Cloning site Green=Tags(s)

MNVHRGSDSDRLLRQEASCLVDDTLAVAQEKEANSLASSGPHNLTYPLGPRNEDLSLDYASQPANLQFPH
IMPLAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPD
TMLGRMFGPGREYNFTRPNEKGEYEIAEGISATVFRTVLDYYKTGIINCPDGISIPDLRDTCDYLCINFD
FNTIRCQDLSALLHELSNDGAHKQFDHYLEELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMG
EEYSQILYSSKLYRFFKYIENRDVAKTVLKERGLKNIRIGIEGYPTCKEKIKRRPGGRSEVIYNYVQRPF
IQMSWEKEEGKSRHVDFQCVRSKSLTNLVAAGDDVLEDQEILMHHPPQVDELDRLNAPLSQMASNDFQD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_173562
ORF Size 1257 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_173562.5
RefSeq Size 5032 bp
RefSeq ORF 1260 bp
Locus ID 222658
Cytogenetics 6p21.31
Protein Families Druggable Genome, Ion Channels: Other
MW 47.3 kDa
Gene Summary Promotes the phosphorylation of AKT family members.[UniProtKB/Swiss-Prot Function]

Citations (1)

Other Versions

Other products for "KCTD20"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 350.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools