CD61 (ITGB3) (NM_000212) Human Tagged ORF Clone

CAT#: RC221606

Reviews ()
Write a review

ITGB3 (Myc-DDK-tagged)-Human integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) (ITGB3)



  "NM_000212" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ITGB3
Synonyms BDPLT2; BDPLT16; BDPLT24; CD61; GP3A; GPIIIa; GT; GT2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221606 representing NM_000212.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGCGAGCGCGGCCGCGGCCCCGGCCGCTCTGGGCGACTGTGCTGGCGCTGGGGGCGCTGGCGGGCGTT
GGCGTAGGAGGGCCCAACATCTGTACCACGCGAGGTGTGAGCTCCTGCCAGCAGTGCCTGGCTGTGAGC
CCCATGTGTGCCTGGTGCTCTGATGAGGCCCTGCCTCTGGGCTCACCTCGCTGTGACCTGAAGGAGAAT
CTGCTGAAGGATAACTGTGCCCCAGAATCCATCGAGTTCCCAGTGAGTGAGGCCCGAGTACTAGAGGAC
AGGCCCCTCAGCGACAAGGGCTCTGGAGACAGCTCCCAGGTCACTCAAGTCAGTCCCCAGAGGATTGCA
CTCCGGCTCCGGCCAGATGATTCGAAGAATTTCTCCATCCAAGTGCGGCAGGTGGAGGATTACCCTGTG
GACATCTACTACTTGATGGACCTGTCTTACTCCATGAAGGATGATCTGTGGAGCATCCAGAACCTGGGT
ACCAAGCTGGCCACCCAGATGCGAAAGCTCACCAGTAACCTGCGGATTGGCTTCGGGGCATTTGTGGAC
AAGCCTGTGTCACCATACATGTATATCTCCCCACCAGAGGCCCTCGAAAACCCCTGCTATGATATGAAG
ACCACCTGCTTGCCCATGTTTGGCTACAAACACGTGCTGACGCTAACTGACCAGGTGACCCGCTTCAAT
GAGGAAGTGAAGAAGCAGAGTGTGTCACGGAACCGAGATGCCCCAGAGGGTGGCTTTGATGCCATCATG
CAGGCTACAGTCTGTGATGAAAAGATTGGCTGGAGGAATGATGCATCCCACTTGCTGGTGTTTACCACT
GATGCCAAGACTCATATAGCATTGGACGGAAGGCTGGCAGGCATTGTCCAGCCTAATGACGGGCAGTGT
CATGTTGGTAGTGACAATCATTACTCTGCCTCCACTACCATGGATTATCCCTCTTTGGGGCTGATGACT
GAGAAGCTATCCCAGAAAAACATCAATTTGATCTTTGCAGTGACTGAAAATGTAGTCAATCTCTATCAG
AACTATAGTGAGCTCATCCCAGGGACCACAGTTGGGGTTCTGTCCATGGATTCCAGCAATGTCCTCCAG
CTCATTGTTGATGCTTATGGGAAAATCCGTTCTAAAGTAGAGCTGGAAGTGCGTGACCTCCCTGAAGAG
TTGTCTCTATCCTTCAATGCCACCTGCCTCAACAATGAGGTCATCCCTGGCCTCAAGTCTTGTATGGGA
CTCAAGATTGGAGACACGGTGAGCTTCAGCATTGAGGCCAAGGTGCGAGGCTGTCCCCAGGAGAAGGAG
AAGTCCTTTACCATAAAGCCCGTGGGCTTCAAGGACAGCCTGATCGTCCAGGTCACCTTTGATTGTGAC
TGTGCCTGCCAGGCCCAAGCTGAACCTAATAGCCATCGCTGCAACAATGGCAATGGGACCTTTGAGTGT
GGGGTATGCCGTTGTGGGCCTGGCTGGCTGGGATCCCAGTGTGAGTGCTCAGAGGAGGACTATCGCCCT
TCCCAGCAGGACGAATGCAGCCCCCGGGAGGGTCAGCCCGTCTGCAGCCAGCGGGGCGAGTGCCTCTGT
GGTCAATGTGTCTGCCACAGCAGTGACTTTGGCAAGATCACGGGCAAGTACTGCGAGTGTGACGACTTC
TCCTGTGTCCGCTACAAGGGGGAGATGTGCTCAGGCCATGGCCAGTGCAGCTGTGGGGACTGCCTGTGT
GACTCCGACTGGACCGGCTACTACTGCAACTGTACCACGCGTACTGACACCTGCATGTCCAGCAATGGG
CTGCTGTGCAGCGGCCGCGGCAAGTGTGAATGTGGCAGCTGTGTCTGTATCCAGCCGGGCTCCTATGGG
GACACCTGTGAGAAGTGCCCCACCTGCCCAGATGCCTGCACCTTTAAGAAAGAATGTGTGGAGTGTAAG
AAGTTTGACCGGGGAGCCCTACATGACGAAAATACCTGCAACCGTTACTGCCGTGACGAGATTGAGTCA
GTGAAAGAGCTTAAGGACACTGGCAAGGATGCAGTGAATTGTACCTATAAGAATGAGGATGACTGTGTC
GTCAGATTCCAGTACTATGAAGATTCTAGTGGAAAGTCCATCCTGTATGTGGTAGAAGAGCCAGAGTGT
CCCAAGGGCCCTGACATCCTGGTGGTCCTGCTCTCAGTGATGGGGGCCATTCTGCTCATTGGCCTTGCC
GCCCTGCTCATCTGGAAACTCCTCATCACCATCCACGACCGAAAAGAATTCGCTAAATTTGAGGAAGAA
CGCGCCAGAGCAAAATGGGACACAGCCAACAACCCACTGTATAAAGAGGCCACGTCTACCTTCACCAAT
ATCACGTACCGGGGCACT

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT
ATCCTGGATTACAAGGATGACGACGATAAG
GTTTAA
>Peptide sequence encoded by RC221606
Blue=ORF Red=Cloning site Green=Tag(s)

MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKEN
LLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPV
DIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMK
TTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTT
DAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQ
NYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMG
LKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFEC
GVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDF
SCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYG
DTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCV
VRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEE
RARAKWDTANNPLYKEATSTFTNITYRGT

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using RC221606 also available, TP321606
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000212
ORF Size 2364 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000212.3
RefSeq Size 4894 bp
RefSeq ORF 2367 bp
Locus ID 3690
UniProt ID P05106
Cytogenetics 17q21.32
Domains INB, EGF
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Regulation of actin cytoskeleton
MW 87.1 kDa
Gene Summary The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "ITGB3"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.