MRP3 (ABCC3) (NM_003786) Human Tagged ORF Clone

CAT#: RC221522

Reviews ()
Write a review

ABCC3 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 3 (ABCC3), transcript variant 1



  "NM_003786" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,306.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "ABCC3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ABCC3
Synonyms ABC31; cMOAT2; EST90757; MLP2; MOAT-D; MRP3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221522 representing NM_003786
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCCCTGTGCGGTTCCGGGGAGCTCGGCTCCAAGTTCTGGGACTCCAACCTGTCTGTGCACACAG
AAAACCCGGACCTCACTCCCTGCTTCCAGAACTCCCTGCTGGCCTGGGTGCCCTGCATCTACCTGTGGGT
CGCCCTGCCCTGCTACTTGCTCTACCTGCGGCACCATTGTCGTGGCTACATCATCCTCTCCCACCTGTCC
AAGCTCAAGATGGTCCTGGGTGTCCTGCTGTGGTGCGTCTCCTGGGCGGACCTTTTTTACTCCTTCCATG
GCCTGGTCCATGGCCGGGCCCCTGCCCCTGTTTTCTTTGTCACCCCCTTGGTGGTGGGGGTCACCATGCT
GCTGGCCACCCTGCTGATACAGTATGAGCGGCTGCAGGGCGTACAGTCTTCGGGGGTCCTCATTATCTTC
TGGTTCCTGTGTGTGGTCTGCGCCATCGTCCCATTCCGCTCCAAGATCCTTTTAGCCAAGGCAGAGGGTG
AGATCTCAGACCCCTTCCGCTTCACCACCTTCTACATCCACTTTGCCCTGGTACTCTCTGCCCTCATCTT
GGCCTGCTTCAGGGAGAAACCTCCATTTTTCTCCGCAAAGAATGTCGACCCTAACCCCTACCCTGAGACC
AGCGCTGGCTTTCTCTCCCGCCTGTTTTTCTGGTGGTTCACAAAGATGGCCATCTATGGCTACCGGCATC
CCCTGGAGGAGAAGGACCTCTGGTCCCTAAAGGAAGAGGACAGATCCCAGATGGTGGTGCAGCAGCTGCT
GGAGGCATGGAGGAAGCAGGAAAAGCAGACGGCACGACACAAGGCTTCAGCAGCACCTGGGAAAAATGCC
TCCGGCGAGGACGAGGTGCTGCTGGGTGCCCGGCCCAGGCCCCGGAAGCCCTCCTTCCTGAAGGCCCTGC
TGGCCACCTTCGGCTCCAGCTTCCTCATCAGTGCCTGCTTCAAGCTTATCCAGGACCTGCTCTCCTTCAT
CAATCCACAGCTGCTCAGCATCCTGATCAGGTTTATCTCCAACCCCATGGCCCCCTCCTGGTGGGGCTTC
CTGGTGGCTGGGCTGATGTTCCTGTGCTCCATGATGCAGTCGCTGATCTTACAACACTATTACCACTACA
TCTTTGTGACTGGGGTGAAGTTTCGTACTGGGATCATGGGTGTCATCTACAGGAAGGCTCTGGTTATCAC
CAACTCAGTCAAACGTGCGTCCACTGTGGGGGAAATTGTCAACCTCATGTCAGTGGATGCCCAGCGCTTC
ATGGACCTTGCCCCCTTCCTCAATCTGCTGTGGTCAGCACCCCTGCAGATCATCCTGGCGATCTACTTCC
TCTGGCAGAACCTAGGTCCCTCTGTCCTGGCTGGAGTCGCTTTCATGGTCTTGCTGATTCCACTCAACGG
AGCTGTGGCCGTGAAGATGCGCGCCTTCCAGGTAAAGCAAATGAAATTGAAGGACTCGCGCATCAAGCTG
ATGAGTGAGATCCTGAACGGCATCAAGGTGCTGAAGCTGTACGCCTGGGAGCCCAGCTTCCTGAAGCAGG
TGGAGGGCATCAGGCAGGGTGAGCTCCAGCTGCTGCGCACGGCGGCCTACCTCCACACCACAACCACCTT
CACCTGGATGTGCAGCCCCTTCCTGGTGACCCTGATCACCCTCTGGGTGTACGTGTACGTGGACCCAAAC
AATGTGCTGGACGCCGAGAAGGCCTTTGTGTCTGTGTCCTTGTTTAATATCTTAAGACTTCCCCTCAACA
TGCTGCCCCAGTTAATCAGCAACCTGACTCAGGCCAGTGTGTCTCTGAAACGGATCCAGCAATTCCTGAG
CCAAGAGGAACTTGACCCCCAGAGTGTGGAAAGAAAGACCATCTCCCCAGGCTATGCCATCACCATACAC
AGTGGCACCTTCACCTGGGCCCAGGACCTGCCCCCCACTCTGCACAGCCTAGACATCCAGGTCCCGAAAG
GGGCACTGGTGGCCGTGGTGGGGCCTGTGGGCTGTGGGAAGTCCTCCCTGGTGTCTGCCCTGCTGGGAGA
GATGGAGAAGCTAGAAGGCAAAGTGCACATGAAGGGCTCCGTGGCCTATGTGCCCCAGCAGGCATGGATC
CAGAACTGCACTCTTCAGGAAAACGTGCTTTTCGGCAAAGCCCTGAACCCCAAGCGCTACCAGCAGACTC
TGGAGGCCTGTGCCTTGCTAGCTGACCTGGAGATGCTGCCTGGTGGGGATCAGACAGAGATTGGAGAGAA
GGGCATTAACCTGTCTGGGGGCCAGCGGCAGCGGGTCAGTCTGGCTCGAGCTGTTTACAGTGATGCCGAT
ATTTTCTTGCTGGATGACCCACTGTCCGCGGTGGACTCTCATGTGGCCAAGCACATCTTTGACCACGTCA
TCGGGCCAGAAGGCGTGCTGGCAGGCAAGACGCGAGTGCTGGTGACGCACGGCATTAGCTTCCTGCCCCA
GACAGACTTCATCATTGTGCTAGCTGATGGACAGGTGTCTGAGATGGGCCCGTACCCAGCCCTGCTGCAG
CGCAACGGCTCCTTTGCCAACTTTCTCTGCAACTATGCCCCCGATGAGGACCAAGGGCACCTGGAGGACA
GCTGGACCGCGTTGGAAGGTGCAGAGGATAAGGAGGCACTGCTGATTGAAGACACACTCAGCAACCACAC
GGATCTGACAGACAATGATCCAGTCACCTATGTGGTCCAGAAGCAGTTTATGAGACAGCTGAGTGCCCTG
TCCTCAGATGGGGAGGGACAGGGTCGGCCTGTACCCCGGAGGCACCTGGGTCCATCAGAGAAGGTGCAGG
TGACAGAGGCGAAGGCAGATGGGGCACTGACCCAGGAGGAGAAAGCAGCCATTGGCACTGTGGAGCTCAG
TGTGTTCTGGGATTATGCCAAGGCCGTGGGGCTCTGTACCACGCTGGCCATCTGTCTCCTGTATGTGGGT
CAAAGTGCGGCTGCCATTGGAGCCAATGTGTGGCTCAGTGCCTGGACAAATGATGCCATGGCAGACAGTA
GACAGAACAACACTTCCCTGAGGCTGGGCGTCTATGCTGCTTTAGGAATTCTGCAAGGGTTCTTGGTGAT
GCTGGCAGCCATGGCCATGGCAGCGGGTGGCATCCAGGCTGCCCGTGTGTTGCACCAGGCACTGCTGCAC
AACAAGATACGCTCGCCACAGTCCTTCTTTGACACCACACCATCAGGCCGCATCCTGAACTGCTTCTCCA
AGGACATCTATGTCGTTGATGAGGTTCTGGCCCCTGTCATCCTCATGCTGCTCAATTCCTTCTTCAACGC
CATCTCCACTCTTGTGGTCATCATGGCCAGCACGCCGCTCTTCACTGTGGTCATCCTGCCCCTGGCTGTG
CTCTACACCTTAGTGCAGCGCTTCTATGCAGCCACATCACGGCAACTGAAGCGGCTGGAATCAGTCAGCC
GCTCACCTATCTACTCCCACTTTTCGGAGACAGTGACTGGTGCCAGTGTCATCCGGGCCTACAACCGCAG
CCGGGATTTTGAGATCATCAGTGATACTAAGGTGGATGCCAACCAGAGAAGCTGCTACCCCTACATCATC
TCCAACCGGTGGCTGAGCATCGGAGTGGAGTTCGTGGGGAACTGCGTGGTGCTCTTTGCTGCACTATTTG
CCGTCATCGGGAGGAGCAGCCTGAACCCGGGGCTGGTGGGCCTTTCTGTGTCCTACTCCTTGCAGGTGAC
ATTTGCTCTGAACTGGATGATACGAATGATGTCAGATTTGGAATCTAACATCGTGGCTGTGGAGAGGGTC
AAGGAGTACTCCAAGACAGAGACAGAGGCGCCCTGGGTGGTGGAAGGCAGCCGCCCTCCCGAAGGTTGGC
CCCCACGTGGGGAGGTGGAGTTCCGGAATTATTCTGTGCGCTACCGGCCGGGCCTAGACCTGGTGCTGAG
AGACCTGAGTCTGCATGTGCACGGTGGCGAGAAGGTGGGGATCGTGGGCCGCACTGGGGCTGGCAAGTCT
TCCATGACCCTTTGCCTGTTCCGCATCCTGGAGGCGGCAAAGGGTGAAATCCGCATTGATGGCCTCAATG
TGGCAGACATCGGCCTCCATGACCTGCGCTCTCAGCTGACCATCATCCCGCAGGACCCCATCCTGTTCTC
GGGGACCCTGCGCATGAACCTGGACCCCTTCGGCAGCTACTCAGAGGAGGACATTTGGTGGGCTTTGGAG
CTGTCCCACCTGCACACGTTTGTGAGCTCCCAGCCGGCAGGCCTGGACTTCCAGTGCTCAGAGGGCGGGG
AGAATCTCAGCGTGGGCCAGAGGCAGCTCGTGTGCCTGGCCCGAGCCCTGCTCCGCAAGAGCCGCATCCT
GGTTTTAGACGAGGCCACAGCTGCCATCGACCTGGAGACTGACAACCTCATCCAGGCTACCATCCGCACC
CAGTTTGATACCTGCACTGTCCTGACCATCGCACACCGGCTTAACACTATCATGGACTACACCAGGGTCC
TGGTCCTGGACAAAGGAGTAGTAGCTGAATTTGATTCTCCAGCCAACCTCATTGCAGCTAGAGGCATCTT
CTACGGGATGGCCAGAGATGCTGGACTTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221522 representing NM_003786
Red=Cloning site Green=Tags(s)

MDALCGSGELGSKFWDSNLSVHTENPDLTPCFQNSLLAWVPCIYLWVALPCYLLYLRHHCRGYIILSHLS
KLKMVLGVLLWCVSWADLFYSFHGLVHGRAPAPVFFVTPLVVGVTMLLATLLIQYERLQGVQSSGVLIIF
WFLCVVCAIVPFRSKILLAKAEGEISDPFRFTTFYIHFALVLSALILACFREKPPFFSAKNVDPNPYPET
SAGFLSRLFFWWFTKMAIYGYRHPLEEKDLWSLKEEDRSQMVVQQLLEAWRKQEKQTARHKASAAPGKNA
SGEDEVLLGARPRPRKPSFLKALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGF
LVAGLMFLCSMMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRF
MDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQMKLKDSRIKL
MSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQLLRTAAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPN
NVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLKRIQQFLSQEELDPQSVERKTISPGYAITIH
SGTFTWAQDLPPTLHSLDIQVPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWI
QNCTLQENVLFGKALNPKRYQQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDAD
IFLLDDPLSAVDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQVSEMGPYPALLQ
RNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSAL
SSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFWDYAKAVGLCTTLAICLLYVG
QSAAAIGANVWLSAWTNDAMADSRQNNTSLRLGVYAALGILQGFLVMLAAMAMAAGGIQAARVLHQALLH
NKIRSPQSFFDTTPSGRILNCFSKDIYVVDEVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAV
LYTLVQRFYAATSRQLKRLESVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYII
SNRWLSIGVEFVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERV
KEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKS
SMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGSYSEEDIWWALE
LSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARALLRKSRILVLDEATAAIDLETDNLIQATIRT
QFDTCTVLTIAHRLNTIMDYTRVLVLDKGVVAEFDSPANLIAARGIFYGMARDAGLA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003786
ORF Size 4581 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003786.4
RefSeq Size 5176 bp
RefSeq ORF 4584 bp
Locus ID 8714
UniProt ID O15438
Cytogenetics 17q21.33
Protein Families Druggable Genome, Transmembrane
Protein Pathways ABC transporters
MW 169.2 kDa
Gene Summary The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.