RAB23 (NM_183227) Human Tagged ORF Clone

CAT#: RC221508

RAB23 (Myc-DDK-tagged)-Human RAB23, member RAS oncogene family (RAB23), transcript variant 2

Product Images

Circular map for RC221508

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY RAB23 (Cat# RC221508, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RAB23 (Cat# TA809380)(1:2000). Positive lysates LY405187 (100ug) and LC405187 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY405187) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC221508 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified RAB23 protein (Cat# TP321508). The protein was produced from HEK293T cells transfected with RAB23 cDNA clone (Cat# RC221508) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RAB23
• Synonyms: HSPC137
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC221508 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTTGGAGGAAGATATGGAAGTCGCCATAAAGATGGTGGTTGTAGGGAATGGAGCAGTTGGAAAATCAA
  GTATGATTCAGCGATATTGCAAAGGCATTTTTACAAAAGACTACAAGAAAACCATTGGAGTTGATTTTTT
  GGAGCGACAAATTCAAGTTAATGATGAAGATGTCAGACTAATGTTATGGGACACTGCAGGTCAGGAGGAA
  TTTGATGCAATTACAAAGGCCTACTATCGAGGAGCCCAGGCTTGTGTGCTCGTGTTCTCTACCACAGATA
  GGGAATCTTTTGAAGCAGTTTCCAGTTGGAGAGAGAAAGTAGTAGCCGAAGTGGGAGATATACCAACTGT
  ACTTGTGCAAAACAAGATTGATCTTCTGGATGATTCTTGTATAAAGAATGAGGAAGCTGAGGCACTGGCA
  AAAAGGTTAAAGTTAAGATTCTACAGAACATCAGTGAAAGAAGATCTAAATGTGAATGAAGTTTTTAAGT
  ATTTGGCTGAAAAATACCTTCAGAAACTCAAACAACAAATAGCTGAGGATCCAGAACTAACGCATTCAAG
  TAGTAACAAGATTGGTGTCTTTAATACATCTGGTGGAAGTCACTCCGGTCAGAATTCAGGTACCCTCAAT
  GGTGGAGATGTCATCAATCTTAGACCCAACAAACAAAGGACCAAGAAAAACAGAAATCCTTTTAGCAGCT
  GTAGCATACCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC221508 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEE
  FDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALA
  KRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLN
  GGDVINLRPNKQRTKKNRNPFSSCSIP
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_183227
• ORF Size: 711 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_183227.2
• RefSeq Size: 4391 bp
• RefSeq ORF: 714 bp
• Locus ID: 51715
• UniProt ID: Q9ULC3
• Cytogenetics: 6p12.1-p11.2
• Protein Families: Druggable Genome
• Protein Pathways: Hedgehog signaling pathway
• MW: 26.7 kDa
• Gene Summary: This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]