TNFAIP3 (NM_006290) Human Tagged ORF Clone

CAT#: RC221337

Reviews ()
Write a review

TNFAIP3 (Myc-DDK-tagged)-Human tumor necrosis factor, alpha-induced protein 3 (TNFAIP3)



  "NM_006290" in other vectors (6)

Reconstitution Protocol

USD 1,085.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "TNFAIP3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TNFAIP3
Synonyms A20; AISBL; OTUD7C; TNFA1P2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221337 representing NM_006290
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAACAAGTCCTTCCTCAGGCTTTGTATTTGAGCAATATGCGGAAAGCTGTGAAGATACGGGAGA
GAACTCCAGAAGACATTTTTAAACCTACTAATGGGATCATTCATCATTTTAAAACCATGCACCGATACAC
ACTGGAAATGTTCAGAACTTGCCAGTTTTGTCCTCAGTTTCGGGAGATCATCCACAAAGCCCTCATCGAC
AGAAACATCCAGGCCACCCTGGAAAGCCAGAAGAAACTCAACTGGTGTCGAGAAGTCCGGAAGCTTGTGG
CGCTGAAAACGAACGGTGACGGCAATTGCCTCATGCATGCCACTTCTCAGTACATGTGGGGCGTTCAGGA
CACAGACTTGGTACTGAGGAAGGCGCTGTTCAGCACGCTCAAGGAAACAGACACACGCAACTTTAAATTC
CGCTGGCAACTGGAGTCTCTCAAATCTCAGGAATTTGTTGAAACGGGGCTTTGCTATGATACTCGGAACT
GGAATGATGAATGGGACAATCTTATCAAAATGGCTTCCACAGACACACCCATGGCCCGAAGTGGACTTCA
GTACAACTCACTGGAAGAAATACACATATTTGTCCTTTGCAACATCCTCAGAAGGCCAATCATTGTCATT
TCAGACAAAATGCTAAGAAGTTTGGAATCAGGTTCCAATTTCGCCCCTTTGAAAGTGGGTGGAATTTACT
TGCCTCTCCACTGGCCTGCCCAGGAATGCTACAGATACCCCATTGTTCTCGGCTATGACAGCCATCATTT
TGTACCCTTGGTGACCCTGAAGGACAGTGGGCCTGAAATCCGAGCTGTTCCACTTGTTAACAGAGACCGG
GGAAGATTTGAAGACTTAAAAGTTCACTTTTTGACAGATCCTGAAAATGAGATGAAGGAGAAGCTCTTAA
AAGAGTACTTAATGGTGATAGAAATCCCCGTCCAAGGCTGGGACCATGGCACAACTCATCTCATCAATGC
CGCAAAGTTGGATGAAGCTAACTTACCAAAAGAAATCAATCTGGTAGATGATTACTTTGAACTTGTTCAG
CATGAGTACAAGAAATGGCAGGAAAACAGCGAGCAGGGGAGGAGAGAGGGGCACGCCCAGAATCCCATGG
AACCTTCCGTGCCCCAGCTTTCTCTCATGGATGTAAAATGTGAAACGCCCAACTGCCCCTTCTTCATGTC
TGTGAACACCCAGCCTTTATGCCATGAGTGCTCAGAGAGGCGGCAAAAGAATCAAAACAAACTCCCAAAG
CTGAACTCCAAGCCGGGCCCTGAGGGGCTCCCTGGCATGGCGCTCGGGGCCTCTCGGGGAGAAGCCTATG
AGCCCTTGGCGTGGAACCCTGAGGAGTCCACTGGGGGGCCTCATTCGGCCCCACCGACAGCACCCAGCCC
TTTTCTGTTCAGTGAGACCACTGCCATGAAGTGCAGGAGCCCCGGCTGCCCCTTCACACTGAATGTGCAG
CACAACGGATTTTGTGAACGTTGCCACAACGCCCGGCAACTTCACGCCAGCCACGCCCCAGACCACACAA
GGCACTTGGATCCCGGGAAGTGCCAAGCCTGCCTCCAGGATGTTACCAGGACATTTAATGGGATCTGCAG
TACTTGCTTCAAAAGGACTACAGCAGAGGCCTCCTCCAGCCTCAGCACCAGCCTCCCTCCTTCCTGTCAC
CAGCGTTCCAAGTCAGATCCCTCGCGGCTCGTCCGGAGCCCCTCCCCGCATTCTTGCCACAGAGCTGGAA
ACGACGCCCCTGCTGGCTGCCTGTCTCAAGCTGCACGGACTCCTGGGGACAGGACGGGGACGAGCAAGTG
CAGAAAAGCCGGCTGCGTGTATTTTGGGACTCCAGAAAACAAGGGCTTTTGCACACTGTGTTTCATCGAG
TACAGAGAAAACAAACATTTTGCTGCTGCCTCAGGGAAAGTCAGTCCCACAGCGTCCAGGTTCCAGAACA
CCATTCCGTGCCTGGGGAGGGAATGCGGCACCCTTGGAAGCACCATGTTTGAAGGATACTGCCAGAAGTG
TTTCATTGAAGCTCAGAATCAGAGATTTCATGAGGCCAAAAGGACAGAAGAGCAACTGAGATCGAGCCAG
CGCAGAGATGTGCCTCGAACCACACAAAGCACCTCAAGGCCCAAGTGCGCCCGGGCCTCCTGCAAGAACA
TCCTGGCCTGCCGCAGCGAGGAGCTCTGCATGGAGTGTCAGCATCCCAACCAGAGGATGGGCCCTGGGGC
CCACCGGGGTGAGCCTGCCCCCGAAGACCCCCCCAAGCAGCGTTGCCGGGCCCCCGCCTGTGATCATTTT
GGCAATGCCAAGTGCAACGGCTACTGCAACGAATGCTTTCAGTTCAAGCAGATGTATGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221337 representing NM_006290
Red=Cloning site Green=Tags(s)

MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALID
RNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKF
RWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVI
SDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDR
GRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQ
HEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK
LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQ
HNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCH
QRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIE
YRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQ
RRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHF
GNAKCNGYCNECFQFKQMYG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006290
ORF Size 2370 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006290.4
RefSeq Size 4705 bp
RefSeq ORF 2373 bp
Locus ID 7128
UniProt ID P21580
Cytogenetics 6q23.3
Domains zf-A20
Protein Families Druggable Genome
Protein Pathways NOD-like receptor signaling pathway
MW 90.1 kDa
Gene Summary This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2012]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.