ACOT1 (NM_001037161) Human Tagged ORF Clone

CAT#: RC221302

Reviews ()
Write a review

ACOT1 (Myc-DDK-tagged)-Human acyl-CoA thioesterase 1 (ACOT1)



  "NM_001037161" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ACOT1
Synonyms ACH2; CTE-1; LACH2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221302 representing NM_001037161
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGACGCTGATCCTGGAGCCCGCGGGCCGCTGCTGCTGGGACGAACCGGTGCGAATCGCCGTGC
GCGGCCTAGCCCCGGAGCAGCCGGTCACGCTGCGCGCGTCCCTGCGCGACGAGAAGGGCGCGCTTTTCCA
GGCCCACGCGCGCTACCGCGCCGACACCCTTGGCGAGCTGGACCTGGAGCGCGCGCCCGCGCTGGGCGGC
AGCTTCGCGGGGCTTGAGCCCATGGGGCTGCTCTGGGCCTTGGAGCCCGAGAAACCCTTGGTGCGGCTGG
TGAAGCGCGACGTGCGAACGCCCTTGGCCGTGGAGCTGGAGGTGCTGGATGGCCACGACCCCGACCCCGG
GCGGCTGCTGTGCCGGGTGCGGCACGAGCGCTACTTCCTCCCGCCCGGGGTGCGGCGCGAGCCGGTGCGC
GCGGGCCGGGTGCGAGGCACGCTCTTCCTGCCGCCAGAACCTGGGCCCTTTCCTGGCATTGTGGACATGT
TCGGAACTGGAGGTGGCCTGCTGGAGTATCGGGCTAGTCTGCTGGCTGGGAAGGGTTTTGCTGTGATGGC
TCTGGCTTACTATAACTATGAAGACCTCCCCAAGACCATGGAGACGCTCCATCTGGAGTACTTTGAAGAA
GCTGTGAACTACTTGCTCAGTCATCCTGAGGTAAAAGGTCCAGGAGTTGGGCTGCTTGGAATTTCCAAAG
GGGGTGAGCTCTGCCTTTCCATGGCCTCTTTCCTGAAGGGCATCACGGCTGCTGTCGTCATCAACGGCTC
TGTGGCCAATGTTGGGGGAACCTTACGCTACAAGGGCGAGACCCTGCCCCCTGTGGGCGTCAACAGAAAT
CGCATCAAGGTGACCAAAGATGGCTATGCAGACATTGTGGATGTCCTGAACAGCCCTTTGGAAGGACCTG
ACCAGAAGAGCTTCATTCCTGTGGAAAGGGCAGAGAGCACCTTCCTGTTCCTGGTAGGTCAGGATGACCA
CAACTGGAAGAGTGAGTTCTATGCTAATGAGGCCTGTAAACGCTTGCAGGCCCATGGGAGGAGAAAGCCC
CAGATCATCTGTTACCCAGAGACAGGGCACTATATTGAGCCTCCTTACTTCCCCCTGTGTCGGGCTTCCC
TGCATGCCTTGGTGGGCAGTCCTATTATCTGGGGAGGGGAGCCCAGGGCTCATGCCATGGCTCAGGTGGA
TGCTTGGAAACAACTCCAGACTTTCTTCCACAAACACTTGGGTGGCCACGAGGGGACAATCCCATCAAAA
GTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221302 representing NM_001037161
Red=Cloning site Green=Tags(s)

MAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLGELDLERAPALGG
SFAGLEPMGLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPDPGRLLCRVRHERYFLPPGVRREPVR
AGRVRGTLFLPPEPGPFPGIVDMFGTGGGLLEYRASLLAGKGFAVMALAYYNYEDLPKTMETLHLEYFEE
AVNYLLSHPEVKGPGVGLLGISKGGELCLSMASFLKGITAAVVINGSVANVGGTLRYKGETLPPVGVNRN
RIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKP
QIICYPETGHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWKQLQTFFHKHLGGHEGTIPSK
V

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001037161
ORF Size 1263 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001037161.2
RefSeq Size 1603 bp
RefSeq ORF 1266 bp
Locus ID 641371
UniProt ID Q86TX2
Cytogenetics 14q24.3
Protein Pathways Biosynthesis of unsaturated fatty acids
MW 46.1 kDa
Gene Summary Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating intracellular levels of acyl-CoAs, free fatty acids and CoASH. More active towards saturated and unsaturated long chain fatty acyl-CoAs (C12-C20).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "ACOT1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Anti-ACOT1 Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.