ACOT1 (NM_001037161) Human Tagged ORF Clone

CAT#: RC221302

ACOT1 (Myc-DDK-tagged)-Human acyl-CoA thioesterase 1 (ACOT1)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ACOT1 (NM_001037161) Human Tagged ORF Clone
Symbol ACOT1
Synonyms ACH2; CTE-1; LACH2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC221302 representing NM_001037161
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGACGCTGATCCTGGAGCCCGCGGGCCGCTGCTGCTGGGACGAACCGGTGCGAATCGCCGTGC
GCGGCCTAGCCCCGGAGCAGCCGGTCACGCTGCGCGCGTCCCTGCGCGACGAGAAGGGCGCGCTTTTCCA
GGCCCACGCGCGCTACCGCGCCGACACCCTTGGCGAGCTGGACCTGGAGCGCGCGCCCGCGCTGGGCGGC
AGCTTCGCGGGGCTTGAGCCCATGGGGCTGCTCTGGGCCTTGGAGCCCGAGAAACCCTTGGTGCGGCTGG
TGAAGCGCGACGTGCGAACGCCCTTGGCCGTGGAGCTGGAGGTGCTGGATGGCCACGACCCCGACCCCGG
GCGGCTGCTGTGCCGGGTGCGGCACGAGCGCTACTTCCTCCCGCCCGGGGTGCGGCGCGAGCCGGTGCGC
GCGGGCCGGGTGCGAGGCACGCTCTTCCTGCCGCCAGAACCTGGGCCCTTTCCTGGCATTGTGGACATGT
TCGGAACTGGAGGTGGCCTGCTGGAGTATCGGGCTAGTCTGCTGGCTGGGAAGGGTTTTGCTGTGATGGC
TCTGGCTTACTATAACTATGAAGACCTCCCCAAGACCATGGAGACGCTCCATCTGGAGTACTTTGAAGAA
GCTGTGAACTACTTGCTCAGTCATCCTGAGGTAAAAGGTCCAGGAGTTGGGCTGCTTGGAATTTCCAAAG
GGGGTGAGCTCTGCCTTTCCATGGCCTCTTTCCTGAAGGGCATCACGGCTGCTGTCGTCATCAACGGCTC
TGTGGCCAATGTTGGGGGAACCTTACGCTACAAGGGCGAGACCCTGCCCCCTGTGGGCGTCAACAGAAAT
CGCATCAAGGTGACCAAAGATGGCTATGCAGACATTGTGGATGTCCTGAACAGCCCTTTGGAAGGACCTG
ACCAGAAGAGCTTCATTCCTGTGGAAAGGGCAGAGAGCACCTTCCTGTTCCTGGTAGGTCAGGATGACCA
CAACTGGAAGAGTGAGTTCTATGCTAATGAGGCCTGTAAACGCTTGCAGGCCCATGGGAGGAGAAAGCCC
CAGATCATCTGTTACCCAGAGACAGGGCACTATATTGAGCCTCCTTACTTCCCCCTGTGTCGGGCTTCCC
TGCATGCCTTGGTGGGCAGTCCTATTATCTGGGGAGGGGAGCCCAGGGCTCATGCCATGGCTCAGGTGGA
TGCTTGGAAACAACTCCAGACTTTCTTCCACAAACACTTGGGTGGCCACGAGGGGACAATCCCATCAAAA
GTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221302 representing NM_001037161
Red=Cloning site Green=Tags(s)

MAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLGELDLERAPALGG
SFAGLEPMGLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPDPGRLLCRVRHERYFLPPGVRREPVR
AGRVRGTLFLPPEPGPFPGIVDMFGTGGGLLEYRASLLAGKGFAVMALAYYNYEDLPKTMETLHLEYFEE
AVNYLLSHPEVKGPGVGLLGISKGGELCLSMASFLKGITAAVVINGSVANVGGTLRYKGETLPPVGVNRN
RIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKP
QIICYPETGHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWKQLQTFFHKHLGGHEGTIPSK
V

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001037161
ORF Size 1263 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001037161.1, NP_001032238
RefSeq Size 1603
RefSeq ORF 1266
Locus ID 641371
Cytogenetics 14q24.3
Protein Pathways Biosynthesis of unsaturated fatty acids
MW 46.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations