Hepsin(HPN) (NM_182983) Human Tagged ORF Clone

CAT#: RC221292

HPN (Myc-DDK-tagged)-Human hepsin (HPN), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Hepsin(HPN) (NM_182983) Human Tagged ORF Clone
Symbol HPN
Synonyms TMPRSS1
Vector pCMV6-Entry
Sequence Data
>RC221292 representing NM_182983
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCAGAAGGAGGGTGGCCGGACTGTGCCATGCTGCTCCAGACCCAAGGTGGCAGCTCTCACTGCGG
GGACCCTGCTACTTCTGACAGCCATCGGGGCGGCATCCTGGGCCATTGTGGCTGTTCTCCTCAGGAGTGA
CCAGGAGCCGCTGTACCCAGTGCAGGTCAGCTCTGCGGACGCTCGGCTCATGGTCTTTGACAAGACGGAA
GGGACGTGGCGGCTGCTGTGCTCCTCGCGCTCCAACGCCAGGGTAGCCGGACTCAGCTGCGAGGAGATGG
GCTTCCTCAGGGCACTGACCCACTCCGAGCTGGACGTGCGAACGGCGGGCGCCAATGGCACGTCGGGCTT
CTTCTGTGTGGACGAGGGGAGGCTGCCCCACACCCAGAGGCTGCTGGAGGTCATCTCCGTGTGTGATTGC
CCCAGAGGCCGTTTCTTGGCCGCCATCTGCCAAGACTGTGGCCGCAGGAAGCTGCCCGTGGACCGCATCG
TGGGAGGCCGGGACACCAGCTTGGGCCGGTGGCCGTGGCAAGTCAGCCTTCGCTATGATGGAGCACACCT
CTGTGGGGGATCCCTGCTCTCCGGGGACTGGGTGCTGACAGCCGCCCATTGCTTCCCGGAGCGGAACCGG
GTCCTGTCCCGATGGCGAGTGTTTGCCGGTGCCGTGGCCCAGGCCTCTCCCCACGGTCTGCAGCTGGGGG
TGCAGGCTGTGGTCTACCACGGGGGCTATCTTCCCTTTCGGGACCCCAACAGCGAGGAGAACAGCAACGA
TATTGCCCTGGTCCACCTCTCCAGTCCCCTGCCCCTCACAGAATACATCCAGCCTGTGTGCCTCCCAGCT
GCCGGCCAGGCCCTGGTGGATGGCAAGATCTGTACCGTGACGGGCTGGGGCAACACGCAGTACTATGGCC
AACAGGCCGGGGTACTCCAGGAGGCTCGAGTCCCCATAATCAGCAATGATGTCTGCAATGGCGCTGACTT
CTATGGAAACCAGATCAAGCCCAAGATGTTCTGTGCTGGCTACCCCGAGGGTGGCATTGATGCCTGCCAG
GGCGACAGCGGTGGTCCCTTTGTGTGTGAGGACAGCATCTCTCGGACGCCACGTTGGCGGCTGTGTGGCA
TTGTGAGTTGGGGCACTGGCTGTGCCCTGGCCCAGAAGCCAGGCGTCTACACCAAAGTCAGTGACTTCCG
GGAGTGGATCTTCCAGGCCATAAAGACTCACTCCGAAGCCAGCGGCATGGTGACCCAGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221292 representing NM_182983
Red=Cloning site Green=Tags(s)

MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTE
GTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDC
PRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNR
VLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPA
AGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQ
GDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_182983
ORF Size 1251 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_182983.1, NM_182983.2, NP_892028
RefSeq Size 2363
RefSeq ORF 1254
Locus ID 3249
Cytogenetics 19q13.11
Protein Families Transmembrane, Protease, Druggable Genome
MW 44.8 kDa
Gene Summary This gene encodes a type II transmembrane serine protease that may be involved in diverse cellular functions, including blood coagulation and the maintenance of cell morphology. Expression of the encoded protein is associated with the growth and progression of cancers, particularly prostate cancer. The protein is cleaved into a catalytic serine protease chain and a non-catalytic scavenger receptor cysteine-rich chain, which associate via a single disulfide bond. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)